KEGG   Chelonia mydas (green sea turtle): 102946100
Entry
102946100         CDS       T02989                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium channel, voltage-dependent, R type, alpha 1E subunit
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04010  MAPK signaling pathway
cmy04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102946100 (CACNA1E)
   04020 Calcium signaling pathway
    102946100 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cmy04040]
    102946100 (CACNA1E)
Ion channels [BR:cmy04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102946100 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 102946100
NCBI-ProteinID: XP_007061211
LinkDB
Position
Un
AA seq 2390 aa
MQATQSCSLLEPEALGDALVSRTASFDVLYEPGSREGEAGLGFEGSSTFDLGLSQYIPVS
PDVIKRRRGGLIEQRDIIKAHEAHKMQSTPQARRKEWEMARFGEAVAGRLGPGDAGSEQN
RIRQGPPAPSGATPGAFKQTKAQRARTMALYNPIPVRQNCFTVNRSLFLFGEDNMVRKYA
KKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIK
IVALGFVFHKGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVS
GIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACYTNNSGELEEL
DPPHPCGVQGCPSGYECKEWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDAL
GATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNG
YRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRNRTEAVNRDSSDEHCVDISSVGTPL
ARGSIRSAKVDGASYFRHKERLLRISVRHMVKSQVFYWTVLSVVALNTACVAIVHHNQPP
WLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDCGVTVGSIFEVVWAVFRP
GTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGM
QLFGGRFNFMDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVRSGMWSSIY
FIILTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPN
MPAIERDRRRRHHMSMWEPRSSQLRDRRRRHHMSVWEQRTSQLRRHMQMSSQEGLNKDAP
PLINPHASIFRRKMPGESVTLEKGEEDHGGSAEHPQAEGLDQPTAGTNSCPNTKEDEKSP
SPRAKRDREQWHQKSCHGNCDLTEQEEGGSGGGGTGIEDRARLRQSQRRSRHRRVRTEGK
EPAGALESRSASQEASLEEANPTEGQQARNEGGKEDTNQEEPLAGEELNRTNEIPASDAA
FAGAMREMSPLKVPHELNEEKNASLTEQDCSGLETSDQALLGSLQMEISRAISRSEPELS
SVTANLEKVTESTTIMIDVQDSTVVQISNKTDGEASPLKEAETKEDEEKEKKKRKKEKSS
ETGKAMVPHSSMFIFSTTNPVRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSD
RNKVLRYFDYVFTGVFTFEMIIKMIDQGLILQDGSYFRDLWNILDFIVVVGALVAFALAN
TLGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMF
IFAVIAVQLFKGKFFYCTDSSKDTEKDCIGNYVDHEKNKMEVKCREWKRHEFHYDNIIWA
LLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVAL
IIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFE
YTIMAMIALNTVVLMMKYYSAPYTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDT
WNIFDFITVIGSITEIILTDTKLVNTSSFNMSFLKLFRAARLIKLLRQGYTIRILLWTFV
QSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFLASLMLLFRSAT
GEAWQEIMLSCLEGKGCEPDTTATSGQHENEHCGTDLAYVYFVSFIFFCSFLMLNLFVAV
IMDNFEYLTRDSSILGPHHLDEFVRIWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRC
PSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADWQQLDSELQKEILA
IWPHLSQKMLDVLVPLPKTSDLTVGKIYAAMMIMDYYKQSKAKKQKQQLEEQKNAPMFQR
MEPSSLPPEILSNAKALPYVQQDTLSGLSSRSGYPSLSPLSPQEIFQLACMDSTHGQFQE
QQSLEPEVREFQSVQPSNRGNYLPVDTQERAVSGRASSMPRLTVDPQVVTDTSSMRRSFS
TIRDKRPNSSWLDEFSMERSSENTYKSRRRSYHSSLQLSARRLNADSGHRSETHRSGGRE
RGRSKERKHLLSPDISRCNSEERSPQADGESPVRRQSRSPSEGRSQTPNRQGMGSLSESS
IPSISDTSTPRRGRRQLPPVPPKPRPLLSYASMMRHSCDNSPQPDEREGGSPLFSQALET
NDTCLTESSSSPQGKQSRHSTPQRYISEPYLALHDDSHASDCGEEETLTFEAAVATSLGR
SNTIGSAPPLRHGWQMPNGHYRRRRRGAAQGVMCGASIDVLSDTEEDDKC
NT seq 7173 nt   +upstreamnt  +downstreamnt
atgcaagccacccagtcctgcagcctgctggagcccgaggctttgggggacgctctggtc
tcccgcacggccagctttgacgtcctctatgagccagggtcccgggagggggaggccggc
ttgggctttgaggggagcagcacttttgacctgggactgagccagtacatcccagtgagc
ccagatgtgatcaagcgccggaggggcgggctaatcgaacagagggacatcatcaaggcg
cacgaggctcacaagatgcagagcacgccgcaggcgaggcggaaggagtgggagatggct
cgctttggggaggcggtggctggccgcctgggacccggagatgcgggctctgagcagaac
aggatccgccagggaccccccgcgccttccggagcgaccccgggagccttcaagcaaacc
aaagcgcagagggcaaggactatggctctgtacaaccccatcccagtccgacagaactgc
ttcacagtcaacagatccctcttcctctttggggaagataacatggtcaggaaatacgcc
aagaagctcatcgactggccgcccttcgaatacatgatcttggccaccatcattgcaaac
tgcatcgtcctagcgctggagcagcacctccccgaggatgacaagacacccatgtcccga
cgactagagaagacagagccttacttcattgggatcttttgcttcgaagctgggattaaa
atagttgctctgggatttgttttccacaagggctcatacctccggaacggctggaacgtc
atggacttcatcgtagtcctcagcggcatccttgccacagctggaactcacttcaacacc
cacgtggacctgcggaccctgagggcagtgcgagtgctcaggcctctgaagctcgtctca
ggcattcccagcttacagatcgtgttgaagtccatcatgaaggccatggtgccccttctc
cagataggcctcttgctctttttcgctattctgatgttcgccatcatcggcctggagttc
tacagtgggaaactgcaccgagcttgctacacgaataattcaggtgaactggaagaactg
gatcccccacatccgtgtggggtgcagggatgcccctcgggttacgagtgcaaggagtgg
attggtcccaatgacgggatcactcagtttgacaacatcctctttgctgtgttgactgtc
ttccagtgcattaccatggaagggtggaccacagtgctgtacaataccaatgatgcctta
ggagccacctggaactggctgtacttcattcccctcatcatcatcggctccttctttgtt
cttaaccttgtcctgggagtgctttccggggaatttgccaaagagcgagagcgggtggag
aaccgcagagccttcatgaagctgcggcgccagcagcagattgaacgggaattgaatggc
tatcgggcctggatagacaaagcagaagaagtaatgctggctgaagagaataaaaatgct
gggacctcagccttggaagtgctcaggagagcaaccatcaaaaggaaccggacagaagcc
gtgaatcgtgactcaagtgacgaacattgcgtcgatatctcctccgtgggtacccctctc
gctcgtggcagcatcaggagcgctaaagtggatggcgcctcctatttccggcacaaggag
cggcttctgcgcatctccgttcgccatatggtgaaatcccaagtgttttattggaccgtc
ttgagcgtggtggctctcaacactgcctgtgtggccattgtccatcacaaccagcctccg
tggctcacccacctcctctactatgcagagttcctgttccttgggctcttcctcctggag
atgtccttaaagatgtatggaatggggccgcgcctttactttcattcctctttcaactgc
tttgactgtggggtcacagtgggaagcatctttgaagtggtctgggctgtcttcagacca
ggcacctctttcgggatcagcgtcttacgagccctccgtcttctgagaatatttaaaata
acaaagtattgggcatccttgaggaatttggtggtctccctgatgagttccatgaagtcg
ataatcagcttgctcttcctccttttcctcttcattgttgtcttcgccctgttgggaatg
cagctgtttggaggcagatttaatttcatggatgggactccttctgcaaactttgacacc
ttccctgcagccatcatgacagtgtttcagatcctgacgggcgaggactggaacgaggtg
atgtacaacgggattcgctcccagggcggagtccgctcaggcatgtggtcctccatctac
ttcatcatcctcaccttgtttggaaactacaccctgctgaatgtgttcttggccatcgct
gtggacaacctagccaatgctcaggagctgacaaaggatgagcaggaggaagaggaggct
tttaaccaaaagcacgccctgcagaaagccaaggaagtcagcccgatgtctgctccaaac
atgcctgcgattgaaagggacagaaggaggagacaccacatgtcgatgtgggagccacgc
agcagccaactgagggacaggagaaggcgacatcacatgtcggtgtgggagcagcgtacc
agtcagctccgtaggcacatgcagatgtccagccaggagggcctcaacaaggacgcccct
cccttgatcaaccctcacgccagcatattcaggaggaaaatgcctggggaaagtgtaacc
ttggagaagggtgaagaggatcatggaggcagcgcagagcacccgcaggcggaaggcctg
gaccaacccactgcaggcaccaactcatgcccaaacaccaaagaggacgagaaaagccca
tcccctcgagccaagagagacagggaacaatggcatcagaaatcatgccacgggaactgt
gatctgactgagcaggaggagggaggcagtggagggggaggcacagggattgaagaccga
gcacggctgaggcagagccagaggcgcagccggcaccggagagtgagaactgaggggaag
gagccagctggggccctggagagcaggtcagccagccaagaggccagcctggaggaagcc
aatcccacggaaggacagcaggccagaaatgaaggggggaaagaggacacgaatcaggag
gagccactggcgggcgaggagctgaacagaacaaatgaaatcccagccagtgatgctgcc
tttgctggggctatgcgggaaatgagccccctcaaagtcccccatgagctcaacgaggag
aagaacgctagcttgacagagcaggactgcagcggcctggagaccagtgaccaagccctg
ctgggcagcttgcagatggagataagcagagccatcagcaggagtgaacccgagctgtcc
tccgtcacagccaacctggagaaagtcaccgagagcaccaccatcatgatcgatgtccaa
gactccactgtggtacagattagcaacaagacggatggagaagccagccccttaaaggag
gcagagacaaaagaggatgaggagaaagagaagaagaaacggaagaaggagaaaagttca
gagacgggcaaagcgatggtgcctcacagctccatgtttatcttcagcacaacaaaccca
gtgcggcgggcctgccattacatcgtgaacctgcgctacttcgagatgtgcatcctcctg
gtgattgccgcgagcagcattgccctggcagcagaggaccctgtcctgaccaactcagat
aggaataaagtcctgaggtattttgactacgttttcacgggtgtcttcacctttgagatg
attataaagatgatagaccagggcttgatcctgcaggacggctcttacttccgagacctc
tggaacatcctggatttcatcgtggtagtcggggcactggtggctttcgccttggcgaat
acattggggaccaacaaaggccgggatatcaaaaccattaagtctctgcgtgtgcttcgg
gtcttgaggcctctgaagaccatcaagcgattgcccaaactcaaggctgtctttgactgt
gtagtgacttccctgaagaatgtcttcaacatacttatcgtctacaagctcttcatgttc
atcttcgcagtcatcgctgttcagctcttcaagggcaaatttttctactgtacggacagc
tctaaggacacagagaaggattgcataggcaactacgtggaccatgagaaaaacaagatg
gaggtgaagtgtcgtgagtggaagcgccatgaatttcactacgacaacatcatttgggct
ttgcttacgctcttcactgtctccactggagaggggtggccacaggtgctgcagcattca
gtggatgtgactgaggaggaccgggggcccagccgcagtaaccgcatggagatgtccatt
ttttacgtggtgtattttgtggtcttccctttcttctttgtcaacatctttgtggctctc
atcatcatcactttccaggagcaaggagacaaaatgatggaggagtgcagtctggagaag
aatgagagggcgtgcattgactttgccattagtgccaaacctctcacgcgctacatgcct
caaaaccgacacaccttccagtaccgcgtctggcactttgtggtctccccatcctttgag
tacaccatcatggccatgatagcgctgaataccgtggtgctgatgatgaagtactattcc
gcaccctacacatatgagttggctcttaagtacttgaacattgcatttaccatggtgttc
tcattggagtgcgtcctgaagatcatagcttttggcttcctgaattatttccgggacacc
tggaacatctttgacttcatcactgtgattggcagcatcacagaaatcatcttgacagac
accaagctggtgaacaccagcagcttcaacatgagtttcctgaagctgttccgggcagct
cgcctcatcaaactactccgccagggctacaccatccgtatcctgttgtggacctttgtg
cagtccttcaaggccctcccatatgtctgtctcttgatcgctatgcttttcttcatatat
gcaatcattgggatgcaggtttttgggaatatcaaattagatgaagaaagccacattaac
cgtcacaacaacttccgcagcttcctggcctcccttatgctcctttttaggagtgccaca
ggtgaggcgtggcaggagatcatgctgtcatgcctggaaggcaaaggctgtgagccagac
accacggcaacgtccggacagcatgagaatgagcactgtggcacggatctggcttacgta
tactttgtttccttcatcttcttttgctccttcctgatgctcaatctgtttgtggctgtc
atcatggacaattttgaatacctgactcgggattcctccatcctggggcctcatcactta
gatgagtttgtccggatctgggcggaatatgacagagctgcgtgtggccgcatccattac
actgagatgtatgaaatgctgactctcatgtcaccaccgctaggcctcggcaagagatgt
ccctccaaagtggcctataagaggctggtgctgatgaacatgcctgtggccgaggacatg
acggtccatttcacctccaccttgatggcgctgatccgaacagcgctggacatcaaaatc
gctaaaggtggtgcagactggcagcagttggattcagagctgcaaaaggagattctggcc
atctggcctcacctgtcccagaagatgttggacgtactagtgcccctgccaaaaacttct
gacctaacagtgggcaaaatatatgcagccatgatgatcatggactactataagcagagc
aaagcaaagaagcagaagcagcagctggaggaacagaaaaacgcccctatgttccagcgc
atggagccttcatctctgcctccagagatcctttctaatgccaaagctttaccttacgtc
cagcaggacaccctttcaggcctgagcagccggagtgggtacccgtcgctgagtccactc
tctcctcaagagatattccaactggcttgtatggattcgacacatgggcagttccaggag
cagcaatctctggagccagaggttagagagtttcaaagcgtgcagccctctaaccgtggc
aactatctccccgtggacactcaggagcgcgctgtatctgggagggcctcctccatgcca
cgcctgactgtggatccccaggtggttacagacacgagctctatgagacgatcattctcc
accatccgggacaagcgtcctaacagctcctggctggatgagttctccatggagcgaagc
agtgaaaacacctacaagtcgcgccggcgcagttaccactcctcgctgcagctgtctgct
cgccgcctgaatgcagactcaggccacaggtccgagacacatcgctcgggcggcagagaa
cgagggcgatccaaagaacgcaagcacctgctgtccccggacatctcccgctgcaactcg
gaggagaggagtcctcaggcagacggcgagtctcctgtccggcgccagtccaggtcaccc
agcgagggcaggtcgcagacgccaaacaggcagggcatgggctctctgagtgaaagctcc
atcccctctatatctgacaccagcaccccgagacgaggccgccggcagctccctccggtc
ccaccaaagccacggccgctcctctcttatgcctccatgatgcggcactcctgtgacaac
tccccgcaacctgacgagagggaaggggggtcccctctgttctcccaggccctggagaca
aacgacacttgcctgaccgagtcttccagctctccgcagggaaagcagagccggcactcc
accccccagcgctacatctcggagccatacctggccctgcacgacgactcccacgcctca
gactgcggcgaggaggagacgctcacctttgaggctgctgtagccaccagtcttggccgc
tccaacaccatcgggtcagcccctcccctgcggcacggctggcagatgcccaacgggcac
tacaggagaaggaggagaggggcggcgcaaggggtgatgtgtggggctagcatcgatgtg
ctaagtgatacggaagaagatgacaagtgctag

DBGET integrated database retrieval system