KEGG   Chelonia mydas (green sea turtle): 102946325Help
Entry
102946325         CDS       T02989                                 

Gene name
MGST3
Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00480  Glutathione metabolism
cmy00980  Metabolism of xenobiotics by cytochrome P450
cmy00982  Drug metabolism - cytochrome P450
cmy00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102946325 (MGST3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102946325 (MGST3)
   00982 Drug metabolism - cytochrome P450
    102946325 (MGST3)
   00983 Drug metabolism - other enzymes
    102946325 (MGST3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cmy02000]
    102946325 (MGST3)
Enzymes [BR:cmy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102946325 (MGST3)
Transporters [BR:cmy02000]
 Other Transporters
  Pores ion channels [TC:1]
   102946325 (MGST3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 102946325
NCBI-ProteinID: XP_007061296
LinkDB All DBs
Position
Un
AA seq 143 aa AA seqDB search
MVVFSKEYGYVVLTGVAGFIMITHLAVNVAKARKKYKVEYPTMYSTDPEHGHLFNCIQRA
HQNTLEVYPSFLFFLAVGGVYHPRVAVGLGITWIIGRVLYAYGYYTGDPRKRNRGAIGSA
ALLGLVGNTLYSAFQHLEWVSRE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggtcgttttctccaaggaatatggctacgtggtcctgaccggtgttgccggctttatc
atgataacgcaccttgctgtgaatgtggcgaaggcacgcaagaagtacaaggtggagtat
ccaaccatgtatagcacggaccctgaacatgggcatctcttcaactgcatccagcgcgca
caccagaacacattggaagtttatccctccttcctgttctttctagccgtgggcggagtc
taccacccgcgtgtcgctgttgggcttggcatcacctggatcattgggagagtcctctat
gcctatggctattacacaggagatcccagaaagcgaaaccgaggggccattggttcagct
gcactcctcggattggtggggaacactttgtactcagccttccagcaccttgagtgggtc
tccagagagtag

DBGET integrated database retrieval system