KEGG   Chelonia mydas (green sea turtle): 102946418Help
Entry
102946418         CDS       T02989                                 

Definition
(RefSeq) coagulation factor XIII A chain-like
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
Enzymes [BR:cmy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102946418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Laminin_G_3 Laminin_G_1 Laminin_G_2
Motif
Other DBs
NCBI-GeneID: 102946418
NCBI-ProteinID: XP_007064308
LinkDB All DBs
Position
Un
AA seq 527 aa AA seqDB search
MSEPTHTDKEKKKTIPPSLSGRRALPPNISNAEEDEVPVMEMTGLVPRGFNLKDFLEVKE
VHMFKGDQDVNKQEHHTDKYYHPKLIVRRGQPFLIQIDFNRPYKPEKDQFWVEYLIGRYP
QQNKGTYIPIPVVEELQSGTWGAKITWKEDSSIRLSIMSAPTCIVGKFRLYVAVLTPYGI
LRTKRNPETDTYILFNPWCPGSISYDGYKSEDDFRMPFTSIPYLTDYPGRYYSEETTAGY
YESTSSGYYPDREKHTFPTEYYVDARDDTTLTAGTSFSGEKNLFPVPEVSREAQVTDLLE
ELGVPRASGVSIVPGSQSNLTAYQLGPSVQVRRETRFILPYGFPQEFSIVSTFRMREDTS
EVVWDLWEVTDREGADQFRLRLYGESYAADIYNAAGAATGSEVTTFENLEKIFDGAWHKL
ALHARRHHITLYVDCQQVGTAPVTHDGAVRTDGDSVLARRVKDDVTPLVDVQQLQLYTDH
NQAVDETCCEVPGVEDDRCASSGLMETTKDCNCQPGEPGYAGLPGPK
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaccaacgcacactgacaaagagaaaaaaaaaacaattccccctagcctgagt
ggccgcagagccctccctccaaacatctccaatgctgaagaagatgaggtccctgtcatg
gagatgactggtttggtacctaggggatttaacctgaaagattttttggaagttaaggaa
gttcacatgttcaagggtgaccaggatgttaacaagcaggagcaccatactgacaagtac
taccaccctaagttgattgtacgccgtggacagcctttccttatccaaattgacttcaac
cgtccttacaaacctgaaaaggaccagttctgggtggaataccttataggtcgttatcca
cagcaaaacaaaggcacttacatcccaatccctgtggttgaagaactgcaaagcgggaca
tggggagccaagattacctggaaggaggacagttccattaggctgtccattatgtctgct
ccgacctgcattgtggggaaattccgcctctacgtcgctgtcctgactccctatggcatc
ctccggacaaagagaaacccagagactgacacctacatactctttaatccctggtgccca
ggaagtatatcttatgatggctataaatcagaagatgatttcaggatgccattcacaagc
atcccttacctcacagactaccctggtagatattactcagaggaaaccacagctggatat
tatgagtcaacatcttcaggttattacccggacagagagaaacacacttttccaacagag
tactatgttgatgctagagatgatacaactttaacagctgggacatcattcagtggagag
aaaaatcttttcccagttcctgaagtctcaagagaagcacaagtcactgatctattagaa
gaactaggagtacccagggcttctggagtcagtattgttcctggatcacaaagcaacctg
acagcttatcagcttggaccaagcgtgcaagtcagaagagaaaccagatttattctccca
tatgggttcccccaggaattctctatagtctccaccttcagaatgagagaggacacctca
gaggtggtctgggatctgtgggaggtgacggacagagaaggtgctgatcagttcagactg
cgtctgtatggtgagagctatgcagctgacatatataatgcagcaggagcagcaacaggt
agtgaggtcaccacctttgagaacctggagaagatttttgatggggcatggcacaagctc
gctctgcatgccaggagacaccatattactttgtatgtagattgccagcaagtgggcaca
gcccctgtcactcatgatggagcagtcagaacagatggagatagtgttttggccaggaga
gtaaaggatgatgttactccactggttgatgtgcagcaacttcagctttacacagaccat
aaccaggcagtggatgaaacctgttgtgaagtacctggagtggaagatgaccggtgtgct
agttcaggacttatggaaacgacaaaggattgcaactgccagcctggagaaccaggttat
gctggccttcctggtccaaag

DBGET integrated database retrieval system