KEGG   Chelonia mydas (green sea turtle): 102946684
Entry
102946684         CDS       T02989                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00220  Arginine biosynthesis
cmy00330  Arginine and proline metabolism
cmy01100  Metabolic pathways
cmy04020  Calcium signaling pathway
cmy04146  Peroxisome
cmy04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102946684 (NOS2)
   00330 Arginine and proline metabolism
    102946684 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102946684 (NOS2)
   04020 Calcium signaling pathway
    102946684 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102946684 (NOS2)
Enzymes [BR:cmy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102946684 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6 Fucokinase
Other DBs
NCBI-GeneID: 102946684
NCBI-ProteinID: XP_007057777
LinkDB
Position
Un
AA seq 1153 aa
MMCPWQFLFKPQTGRKVSPKEDINNNVEKAVLKVHGFAKEEAAQLNDLSNKQDEMPRTIT
AGEKPPQNGIQPMSQISGCPRHLKVKNWGNGTSFNDTLHQTAKAVLNCKAKACQGALMNP
KGLVKGPRDSPVPPEEILPQAIEFINQYYNSLKEPQPEEHQQRMQSVTEEIEKTGTYQLT
KDELIFATKLAWRNAPRCIGRIQWSNLQVFDARNCTTAKEMFEHICRHLEYATNNGNIRS
AITVFPQRTDGKHDFRLWNSQLIRYAGYQMPDGSILGDPATVEFTQLCIELGWKPKYGRF
DVIPLILQANGQDPEIFELPPELVLEVSMEHPKYEWFKELDLKWYALPAVANMLLEAGGL
EFTACPFNGWYMGTEIGVRDFCDVQRYNILQEVGRRMGLETNKLSSLWKDRAVIEVNVAV
LHSFQKQNVTIMDHHSAAESFMKYMQNEYRLRGGCPADWVWLVPPVSGSITPVFHQEMLN
YVLTPFYYYQVEAWKTHVWHDEKRRPKKREIKFRVLAKAAFFAAALVRKTMAARTKATVI
YATETGKSETLANNLCALFNCAFNTKVLCMDEYKLSDLEKETLLLVVTSTFGNGDSPGNG
KKLKNALFTLKQLSKKFRYAVFGLGSTMYPEFCAFAHAIDQKLAQLGASPLTQTGEGDEL
NGQEEAFRTWAVNAFKTACETFDIRGKNNIQLPKVYTSNETWNPKNYRIAYDSQPLDLSK
ALGNIHAKDVIPMTLKFRQNLQSLKSSRVTILLKLSCETNQEVHYLPGEHVGIFPGNQPE
LVSGIIEHVKDAPPTDQTIRLETCNDGGYWTSDKKIPPCTLSQALMYFLDVTTPPSQHLL
KKLSRLATEEGDKHRLEVLCHVSEYNKWKFFNSPTILEVLKEFPSTQVSTSFLLTQLPLL
KPRYYSISSSRDMTPREIHLTVAVVNYRTRDGQGPLHHGVCSTWLNTIALQETVPCFVRS
ASGFRLPKDPAKPCILIGPGTGIAPFRSFWQQRLYDLEKKGIKGSGMTLLFGCRQSDMDH
LYREETQEMKRKGVLKEVYTAYSRQPGQAKVYVQDILQSKLQAEVHQALHEDEGHLYVCG
DVRMARDVSQTLKEMFTKKLKLTEEQAEDYIFQLKSQKRYHEDIFGAMVPHEGKRNASAL
KPTSPRTTQQLMF
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgatgtgcccttggcagttcctattcaagccccaaaccggtcggaaagtgtcccccaag
gaggatataaacaataatgtggaaaaagcagtcctgaaagttcacggcttcgcaaaagaa
gaagccgcccagctaaatgatctgagcaacaagcaggacgagatgccgcgcaccataact
gcaggagagaaacctccgcagaacggcatccaacccatgagccaaatatctgggtgtccg
agacatttaaaagttaaaaactggggaaatggaaccagctttaatgacacgttgcaccag
acagcaaaggcggttctcaactgcaaggccaaggcctgccaaggggcactcatgaacccc
aaaggcttggtgaaaggcccaagagacagtccagtcccaccggaagagattttaccccag
gcaatagaattcatcaatcaatactacaattcacttaaagagccacaaccagaagaacac
cagcagcgaatgcaatcagtaaccgaagagatagaaaaaacaggaacctaccagctgaca
aaagatgaactcatttttgcaaccaaactggcatggagaaatgctccgagatgcattggg
agaatacaatggtccaacctacaggtgtttgatgcacgtaactgtactacagccaaggaa
atgtttgaacatatctgtcgtcatcttgaatacgccacaaacaatggaaacatcagatcg
gccatcactgtcttccctcagaggactgatgggaaacatgatttccgtttgtggaacagc
cagctcatccgatatgctgggtaccaaatgccagatggctccatcttgggagacccagct
actgtggagtttacacagttgtgcatcgagcttgggtggaagcccaaatatggccgcttt
gatgtcattccactgattctccaagcaaacggccaagacccagaaatatttgaactgccg
ccagaacttgtccttgaagtgtcaatggaacatccaaagtatgaatggtttaaggaactc
gatttgaagtggtacgcgctgccagcggtcgccaatatgctgcttgaagcggggggcctg
gaatttacagcttgcccttttaatggctggtacatggggacggagataggcgtgcgagac
ttctgtgacgtacagcgctacaatatcctgcaggaagtagggagaaggatgggtctggaa
accaacaaactttcctcattatggaaagatcgagcggtgatagaggttaacgtggccgtg
cttcatagtttccaaaaacaaaacgtcaccatcatggatcaccactccgcggcggagtct
ttcatgaagtacatgcagaacgagtaccgccttcgaggagggtgcccagccgactgggtc
tggctcgtgccgccggtatcaggcagcattaccccagtgtttcaccaggagatgctgaac
tatgtcctcacacctttctactattaccaggtggaggcttggaaaacacatgtctggcac
gatgagaaacgcaggccaaagaaaagggagatcaagttcagagttttggcaaaggctgcg
ttctttgcagctgcattggtgcggaaaacgatggcagccaggaccaaggcaacagtgatc
tatgcaaccgagactgggaaatctgaaacgctggccaacaacctgtgcgccttgttcaat
tgtgccttcaataccaaggtcctctgcatggatgagtacaagctcagtgacctggaaaaa
gaaaccctccttctagtggtgaccagcacttttggaaatggtgactctccaggcaacgga
aagaaactgaaaaatgccctgttcactctgaaacagctgagcaaaaaattcagatatgct
gtatttggcctggggtcaaccatgtatccagagttttgtgccttcgctcatgccattgac
caaaagcttgcacagctaggcgcctctccgctcacccaaacaggtgaaggggacgaactt
aatgggcaggaagaagcctttcgcacctgggcagttaatgcattcaagactgcctgtgag
acttttgacatccgtggaaaaaacaatattcagttacccaaggtgtacacctcaaatgaa
acctggaatcccaagaattacaggatagcatatgactcccagcctttggacttgagtaaa
gcacttggaaacatacatgcaaaagatgtgattcccatgacgctcaagttcaggcagaat
ctgcaaagtttaaaatccagtcgtgttaccatcctacttaagctttcctgtgagactaat
caggaagtgcactatctgccgggagaacatgtcgggatttttccaggcaaccagccagaa
ttagtcagtggcatcattgagcatgttaaggatgcaccaccaactgatcagaccatcaga
ctggaaacctgcaatgatggtggctactggacaagtgacaagaaaattccaccctgtaca
ctttcccaagccctgatgtatttccttgatgtcactacaccaccctcccaacatctgcta
aaaaaactctcccggctggcaacagaggaaggagacaaacacagactggaagtcttatgt
catgtgagtgagtacaacaagtggaagtttttcaacagccccaccattttggaggtactg
aaagagtttccttccacccaagtctccacgtcttttttactgactcagctgcctttgttg
aaaccccggtactattccattagctcctcacgggacatgacgcccagagagatccatttg
acagttgcagtggtcaactacaggacaagggatggtcaaggtcctctgcaccatggtgtt
tgcagcacatggctgaatacgatagctctccaggagacagtcccatgctttgtgcgcagt
gctagtggattccggcttccgaaggaccccgccaagccctgcattctgatcggccctggg
acaggaattgctccattcagaagcttctggcagcagcgcctctatgacttagaaaagaaa
ggaattaaaggcagcggcatgacattgttgtttggctgccggcaatcagacatggatcat
ctctacagagaagaaactcaagaaatgaaaagaaaaggagtgctgaaagaggtctacact
gcctactcccggcaacccggccaagctaaagtctacgttcaagacattcttcaaagcaag
ctgcaggcagaagtgcaccaagccttacatgaagatgaagggcatttgtatgtctgcggg
gacgtgcgcatggccagggacgtctcccagaccttgaaggagatgttcacaaagaaattg
aagctgacggaggaacaggctgaagactacatcttccagctgaagagccaaaagcgatac
catgaggacatattcggggctatggttccacacgagggcaagagaaatgcaagcgctttg
aaacccaccagcccaagaaccactcaacagttaatgttttag

DBGET integrated database retrieval system