KEGG   Chelonia mydas (green sea turtle): 102947389Help
Entry
102947389         CDS       T02989                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04010  MAPK signaling pathway
cmy04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102947389 (TGFA)
   04012 ErbB signaling pathway
    102947389 (TGFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1180 Syndecan EphA2_TM Trp_oprn_chp
Motif
Other DBs
NCBI-GeneID: 102947389
NCBI-ProteinID: XP_007065549
LinkDB All DBs
Position
Un
AA seq 189 aa AA seqDB search
MVSSAGEIAVVALGILLAVCHALENTTSALSGPPVAAAVRSHFNDCPDSHSHFCFHGTCR
FLVQEEKPACVCHSGFVGTRCEHADLLAVVAANQKKQTITALVVVSVVASVVLIVACVLI
HCCRIRKHCEWCRAFICRHEKPSGLLKGGTSCCHSETGRRNNGRSNSFLPTVKLVGRGDE
DPAKELSSV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggtcagctccgccggggagattgccgtggtcgcgctgggtattttactagctgtgtgc
catgccttggagaacacaacatctgccttgagtggtcccccagtggctgccgccgtccgt
tcccattttaacgactgtcccgactcccacagtcacttctgcttccacgggacctgcagg
tttctggtgcaagaggagaagccagcatgtgtctgccattctgggtttgtcgggacgcga
tgcgaacacgcagacctccttgcagtggtagctgccaatcagaagaaacaaaccatcact
gccttggtggtggtttcagtggtagcgtccgtcgtccttatcgtggcctgtgtactaata
cattgctgtcggataagaaaacattgtgagtggtgccgagccttcatctgcagacacgag
aagcccagtgggctcctgaaggggggaacttcctgttgccattcagagacaggtaggagg
aacaacggtcgtagcaacagcttccttccaacagttaaattggttggccgtggagatgaa
gatcctgctaaggagctgagttccgtttag

DBGET integrated database retrieval system