KEGG   Chelonia mydas (green sea turtle): 102947923
Entry
102947923         CDS       T02989                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04068  FoxO signaling pathway
cmy04110  Cell cycle
cmy04115  p53 signaling pathway
cmy04218  Cellular senescence
cmy04310  Wnt signaling pathway
cmy04340  Hedgehog signaling pathway
cmy04371  Apelin signaling pathway
cmy04510  Focal adhesion
cmy04530  Tight junction
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102947923 (CCND1)
   04340 Hedgehog signaling pathway
    102947923 (CCND1)
   04371 Apelin signaling pathway
    102947923 (CCND1)
   04068 FoxO signaling pathway
    102947923 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102947923 (CCND1)
   04115 p53 signaling pathway
    102947923 (CCND1)
   04218 Cellular senescence
    102947923 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102947923 (CCND1)
   04530 Tight junction
    102947923 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102947923
NCBI-ProteinID: XP_007068004
UniProt: M7BIT0
LinkDB
Position
Un
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKNRLQLLGATCMFVASKMKETIPLT
AEKLSIYTDNSIRPDELLQMELFLVNKLKWNLAAMTPHDFIEHFLTKMPVAEDTKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGDTNTFLSYQSLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNISSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgttgtgaagtggaaaccatcagaagagcctatctagatgcc
aacctactaaatgacagggttctgcagacaatgctgaaggcagaggagacctgctcgccc
tctgtgtcctacttcaagtgcgtgcagaaggaaatcttgccatatatgaggaaaatagtt
gccacttggatgctggaggtttgcgaggagcagaaatgtgaagaggaagttttccccttg
gctatgaattatttggacagatttttgtcgtttgaacccctcaagaaaaaccgattgcaa
cttctgggagctacctgcatgtttgtggcttcaaaaatgaaggaaacgattcctctaacc
gcagaaaaactgagcatttacaccgacaactccattagacccgacgaattactgcaaatg
gagctgtttctggtgaataagctgaaatggaatctggccgcaatgacccctcatgatttc
attgaacatttccttactaaaatgcctgtggcggaggacaccaagcaaatcatccgtaaa
catgcccagacttttgtggctctgtgcgctacagatgttaagtttatttcaaacccacct
tccatgatcgcagctgggagtgtggtagcagccgtgcaaggccttcacctgggagacact
aacactttcctctcctatcaaagtctcacacatttcctatcacaagttatcaaatgtgac
ccggattgtttacgagcttgccaagaacagattgaatccctcctcgaatccagtctacgc
caggcacagcaacacaacatatcttcagaaacaaagactgttgaggatgaagcagacctt
tcctgcacacccaccgatgtgcgagacgtgaacatttaa

DBGET integrated database retrieval system