KEGG   Chelonia mydas (green sea turtle): 102948110Help
Entry
102948110         CDS       T02989                                 

Gene name
SI
Definition
(RefSeq) sucrase-isomaltase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00052  Galactose metabolism
cmy00500  Starch and sucrose metabolism
cmy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102948110 (SI)
   00500 Starch and sucrose metabolism
    102948110 (SI)
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102948110 (SI)
    3.2.1.20  alpha-glucosidase
     102948110 (SI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102948110
NCBI-ProteinID: XP_007055582
LinkDB All DBs
Position
Un
AA seq 1913 aa AA seqDB search
MGKKKFSGLEISLIVLFCLVVIVACILVALLATGQPGLQDFSPDCPAVNVAERIDCIPDR
VATKSLCTLRGCCWSPQEETQIPWCFFSKSHGYKVEGGVKQTDTGFMAKLKRLPSPSLFG
NDINTVQLTGEYQTTNRFRFKITDPNKKRFEVPHEYVEAFGGPAASNLKYKVDIIQNPFG
ITVMRMSSGTILFNTSIGPLQYADQYLQLSIKLPTGNIYGIGEHVHTQYRHDVNWRTWPI
FTRDAFPNGGTHNLYGAHTFFLCLENNSGASFGVFLMNSNAMEFVLQPAPAATYRTTGGI
LDFYVFLGDTPEQVVREYVKLIGMPAMPSYWSLGFQLSRWNYTSLDELKVVVARNRAIGI
PYEIQYTDIDYMEEKKDFTYDQEKFKDLPKFAVDLHDHGQKYIIILDPAIAISPLLNKTS
YLTYERGMNKAVWVNESDGQTKLIGEVWPGRTVFPDYTNPECTNWWVEECKLFYDQVKYD
GIWIDMNEVSSFIKGSVLGCQQNNLNYPPFTPSILDGLMYSKTLCMDAVQSWGKHYDVHS
LYGYSMTLSTDKAIQAVFPGKRSLTISRSTFAGSGKYTGHWLGDNAATWNDLRWAITGML
EFNLFGIPYIGADICGFFDNVTEELCRRWMQVGAFYPFCRNHNAENYAPQDPAVFGADSV
LVRSSKNYLNIRYTLLPYLYTLFYKAHTQGDTVVRPLLHEFYSDDATWAIDRQFLWGPGL
LITPVLDPGVETVTAYIPDAVWYDYETGRREVWRKQQAQMYLPADKLGLHLRGGYIFPIQ
QPANTTLYSRKNPMGLIIALDDKGQAAGDLFWDDGETRDTVETKNYVHYQFSVTNVTHVT
GLKLELGKSYLLEWNQELNNNEKFNCHPSPNATQQNCEALNCIWKVTHVTGLKLELGKSY
LLEWNQELNNNEKFNCHPSPNATQQNCEALNCIWKPVSTGNDPSCYYPSDYGYSVSQITY
TSSGLSVNLNRNGNYANRAKDSTTPINILRLDVKYHENNMLQFKIYDYNNKRYEVPVPLN
IPSSPTSTYENRLYEVAIQNNPFGIQIRRKSTGTVIWDSQVPGFTFSDMFIQISTRLPSE
YVYGFGETEHTTFRRDMNWNTWGMFAKDQPPGYKLNSYGVHPFYMGLENDGNAHGVLLLN
SNAMDVTFQPTPALTYRTIGGILDFYMVLGPTPELVVQEYTALIGRPVMPPYWALGFQLC
RYGYKNDIEISDLYEAMKAARIPYDVQYADIDYMDRQLDFTLSPNFTGLPALVDRMKKEG
MRFIIILDPAISGNETNYLAYTRGVQEDVFIKWPNSSEIVWGKVWPDFPNVVVNESLDWD
TQVQLYRAYAAFPDFFRNTTAQWWQREIREYHTNPNQPEKSVKFDGLWIDMNEPASFVHG
AVEDCRNQELNNPPYMPRLESQSRGLNHKTLCMESEQFLPDGTPVRHYDVHNLYGWSHTK
PTYDALQSTTNERGIVITRSTYPSSGKWAGHWLGDNTAAWDQLYKSIIGMMEFSLFGISY
TGADICGFFNDAEYYMCARWMQLGAFYPFSRNHNTIGTKRQDPVAFDEQFENISRDVLNI
RYTLLPYLYTLMYEAHVHGSTVVRPVLHEFVEDKKTWDVYKQFLWGPALLISPVLENATS
VLAYIPNARWYDYYTEEYIGLKGQSYNLSAPLEHINLHIRGGYIIPWQDPANNTFYSRQN
SMGLTVALDDNGFAQGQLYWDDGKSTDAYEQGAYLLETFNASQVGIRXHLVLSVLEIKVL
NNGYTDPNNLKFDEIKILGVVRGPLAVTVKQNGVTVPSLHNVNYDATKELLHITGLQLEL
GKPYSVDWSSQGSLVEDNEKFNCYPDSGASEENCTARGCIWQIYDANNKRYEVPVPLFLP
STPTSTEAGRLYEVTIKNNPFGIQIRRKSTGTIINNILIIDAISEYSVSGSSQ
NT seq 5739 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaagaagttcagcggattagagatctctctgattgtcctattttgtttggtg
gtgattgtagcctgcattctggtggcacttttagcaacaggacaacctggactccaagac
ttttctccagactgtccagcagtaaacgtcgcagagagaattgactgcattccagatcga
gtggcaacaaagagcttatgtacactgcgtggctgttgctggagtccacaagaggaaaca
caaataccctggtgcttcttctccaagagtcatgggtataaagtagagggaggtgtgaag
caaacagatacaggttttatggctaagttaaagaggctgccttcaccttccctctttgga
aatgatattaacactgtccagctcacaggagaatatcagacaacaaatcgcttccggttc
aagatcactgatcctaataaaaaaagatttgaagttcctcatgagtatgtagaagctttt
ggtggacctgcagcctccaatttaaagtataaagtcgatatcattcagaacccttttggt
atcactgtgatgagaatgagcagcggcacaatactgttcaatactagcataggaccactt
cagtatgctgaccagtatttacagctctcaatcaaactgcccactggaaacatttatgga
atcggagaacacgtccacacacaataccggcatgatgttaactggagaacgtggcccatc
tttaccagagatgctttccccaatggaggcactcataacttatatggagctcacactttc
ttcttgtgcttggaaaataacagtggagcctcttttggtgtgttcttaatgaacagcaat
gccatggaatttgttctccagcctgccccagcagcaacttacagaacaactggtggaatt
ctagatttttatgtcttcttaggagacactccagagcaagttgttcgagagtatgtaaag
ctgataggaatgcctgcaatgccttcatactggagtcttggattccaacttagtcgctgg
aattatacctctcttgatgagttgaaagttgttgtagcaagaaacagagcaattgggata
ccctatgaaattcaatacactgatattgactatatggaggagaagaaagactttacttat
gaccaagagaaatttaaggaccttcctaaatttgctgtggacctacatgaccatggacaa
aaatacattattatactggaccctgccattgccatctcccctctccttaataagacttca
tatcttacctatgaacgaggaatgaacaaggcagtgtgggtaaatgaatcagatggacaa
acaaaactcattggagaggtgtggccaggacggactgtgttccctgactacaccaaccca
gaatgtaccaactggtgggtggaagaatgtaagctcttctacgatcaagtgaagtatgat
gggatttggattgacatgaatgaagtatccagctttataaaaggttcagtacttggctgt
cagcaaaacaacttaaactatcctcctttcactcccagtattctcgatggactcatgtat
tcaaagacactttgcatggatgcagtgcaatcctggggaaaacactatgatgttcacagt
ctatacggctattccatgaccctatctactgataaagctatacaagctgttttccctgga
aaaagaagccttactatttctaggtctacttttgctggatcaggaaaatacacaggacat
tggctcggggataatgctgctacatggaatgatctgagatgggcgataacaggaatgctg
gaatttaacctctttgggataccttatattggtgcagatatttgtggcttctttgataat
gtcacagaagaactttgcaggcgatggatgcaagttggagcattttatccattttgcaga
aatcacaatgctgaaaattatgcgcctcaggatccggctgtatttggggcagattctgtt
ttggtgagatcatcaaagaactacttgaacattcgatacactttactgccctacctctat
acccttttttacaaagctcatacacaaggagacacggtagtgagaccacttcttcacgag
ttctattcagatgacgcaacatgggctattgatcgacagttcttgtggggccctggtctt
ctgatcactcctgtactggacccaggtgtggaaacagtgacagcatatattcctgatgca
gtatggtatgactatgaaacaggtagaagagaagtatggagaaaacaacaagcacagatg
tatctcccagcagacaaactaggacttcatctgagaggaggctacatatttcctattcag
cagccagctaatacaacattgtacagccgcaagaatccaatgggactcataattgcatta
gatgacaagggacaagcagctggagatttattctgggatgatggagaaactagagataca
gtggaaactaaaaactacgttcattaccagttttcagttaccaatgttacccatgtaact
gggcttaaacttgaattaggaaaatcatacttactggaatggaatcaagagttaaataac
aatgaaaaatttaattgtcaccctagccccaatgcaacacaacagaattgtgaagccttg
aactgtatctggaaggttacccatgtaactgggcttaaacttgaattaggaaaatcatac
ttactggaatggaatcaagagttaaataacaatgaaaaatttaattgtcaccctagcccc
aatgcaacacaacagaattgtgaagccttgaactgtatctggaagcctgtctccactggt
aatgatccatcctgttactatccttctgactatggttattctgtcagtcaaattacatac
acctcttcaggtttatcagtgaacctcaacagaaatggtaattatgctaaccgtgctaag
gattctactactcctatcaatatacttcgcttggatgtgaaatatcatgagaacaatatg
ctgcaatttaagatttatgattacaacaataaaagatatgaggttccagtaccactaaat
atccctagcagtcccacaagtacatatgagaatagactctatgaagtagcgattcagaac
aatccattcggcatccagattcgacgcaaaagcacagggacagttatttgggattctcag
gtacctggcttcacctttagcgacatgttcattcagatttctacccgtcttccatcagag
tatgtctatggatttggtgaaactgaacacactacgtttcggcgtgatatgaactggaac
acctggggaatgttcgccaaagatcagccccctggttacaaactgaactcttatggtgtc
catcctttttacatgggcttagaaaatgatggaaatgctcatggagtcctcttgcttaac
agcaatgcaatggatgtcacattccagccaactcctgctctgacatatcgcactatcgga
ggaattctggacttttacatggtgttgggcccaaccccagagcttgttgttcaggaatac
actgcactgattggacgaccggtcatgccaccatactgggctttgggattccagttatgc
cgttatggatacaaaaatgacatagaaatctctgacctgtacgaagcaatgaaggcagct
cggataccttatgacgtacaatacgcggatatcgattacatggatcggcaattggacttt
accctcagcccaaacttcactggactaccagctctggttgacagaatgaaaaaggaagga
atgagattcatcattatcctggatccagccatttcaggcaacgaaaccaattatctagcc
tacacaagaggtgtccaggaagatgtttttattaaatggcccaatagcagtgaaattgta
tggggaaaggtttggccagattttcccaacgtagttgttaatgaatcactagactgggat
actcaagtgcagctatatagagcttatgcagctttcccagattttttccgcaacaccaca
gctcagtggtggcaaagagaaataagagaataccacactaacccaaatcaaccagagaaa
agtgtgaagtttgatggcttgtggattgacatgaatgaaccagcaagctttgttcatgga
gcagttgaagactgtagaaaccaagagctaaacaatcctccctatatgcccaggttggaa
tcacagtcacgtgggttgaatcacaaaaccttatgcatggaaagcgagcagttcctgcca
gatggaacccctgttagacactatgatgtgcataatctctatggatggtcacatacaaaa
cctacctatgatgctttacagagcaccactaatgaacgtggaattgttatcacccgttca
acgtatccctctagtggaaaatgggctggacactggcttggcgataacaccgcagcttgg
gatcaactttataaatctataattggtatgatggaattcagcctttttggaatatcctat
actggagcagacatttgtggcttcttcaatgatgcagagtattacatgtgtgcccgttgg
atgcagctgggagcattttacccattttccagaaatcataataccataggcacaaagagg
caagatcctgtggcctttgatgaacaatttgaaaacatttccagagatgtactcaatata
agatacacactgttaccctatctgtacactttaatgtatgaagcccacgttcatggtagc
actgtagtgcgtcctgtcctccatgagtttgtggaagacaaaaaaacatgggatgtatac
aaacaatttctgtggggacctgcgctgctcattagccctgtactggagaatgctacatca
gtgttggcttatatacccaatgcacgctggtatgattattacacagaggaatatattggt
ttaaagggacagtcctataacctgtcagctcctcttgaacatatcaaccttcatatccgc
ggaggctacatcatcccatggcaggaccctgctaataataccttttacagccgacaaaac
tcaatgggacttactgttgctttagatgataatgggttcgctcaaggtcagctttactgg
gatgatgggaagagcactgatgcatatgaacagggtgcttatctgttagaaacatttaat
gcaagtcaggtgggtatcaggtgacatcttgttcttagtgttttagagattaaggttttg
aacaatggatacactgacccaaacaatttaaaatttgatgaaattaaaatcttgggagtt
gtcagaggacctttagctgttacagtaaaacaaaatggcgtgacagttccatctctccat
aatgttaactatgatgctacaaaagagctcctgcatattactggccttcagcttgaattg
gggaaaccctactcagtggactggtcttcacaggggtcattggttgaagacaatgaaaaa
tttaactgttatcctgattcaggtgcatcagaagaaaattgtactgctcgtggctgtatc
tggcagatttatgatgccaacaataaaagatatgaagttccagtaccactatttctccct
agtactccaacaagtacagaagcaggtcgactctatgaagtgaccattaagaacaatcca
tttggtatccagattaggcgcaaaagcaccggaacaattatcaacaacatccttataatt
gatgctatcagtgaatatagtgtttctggtagcagtcag

DBGET integrated database retrieval system