KEGG   Chelonia mydas (green sea turtle): 102948326Help
Entry
102948326         CDS       T02989                                 

Definition
(RefSeq) caspase-1-like
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04217  Necroptosis
cmy04621  NOD-like receptor signaling pathway
cmy04623  Cytosolic DNA-sensing pathway
cmy04625  C-type lectin receptor signaling pathway
cmy05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102948326
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102948326
   04623 Cytosolic DNA-sensing pathway
    102948326
   04625 C-type lectin receptor signaling pathway
    102948326
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102948326
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cmy01002]
    102948326
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cmy04131]
    102948326
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     102948326
Peptidases and inhibitors [BR:cmy01002]
 Cysteine peptidases
  Family C14: caspase family
   102948326
Membrane trafficking [BR:cmy04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    102948326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 CARD HTH_37
Motif
Other DBs
NCBI-GeneID: 102948326
NCBI-ProteinID: XP_007054624
LinkDB All DBs
Position
Un
AA seq 380 aa AA seqDB search
MADRKLSNVRIRFLESVSKAVISTLLDDLLERRVLNEEEVEEVRESCSKRSDQARCLIDG
VRKKGARASEIFIERLCFRDVHLATELELSPPSGSAAETQPAPSQEWICPCPQEFVQRIQ
KEEAKEIYSIRDKATRTRLALIICNVEFDHLRRRDGADVDMNGMKRLLEGLGYKVEIHCN
LNAQAMVETLKQFAARNEHRTSDSTFLVLMSHGVRAGLCGTNCQDESTDILPIDTIYSTF
NNRNCQALLEKPKVIIIQACRGENHGQVWVSDSAELPGDGSSLAPLPPEGLEDDASHQIH
VESDFICFQATTPDTLSWRSPKTGSVFITSLIEQLRTNAWRLPLEEIFRKVQLSFQNFPR
QMPTKERTTMIKKFYLFPGH
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccggaagttaagcaacgtgcggatcaggtttttggagagtgtgagcaaggct
gtgatcagcaccctcctggacgacctgctggagagacgggtgctgaacgaggaggaagtg
gaggaggtgagggagagctgcagtaagaggagtgaccaagcccggtgtctgattgatggg
gtgaggaaaaagggtgccagagccagtgaaatattcatcgagcgcctctgcttcagagat
gtccacctggccacagagctggagctcagccccccctcggggtctgctgcagaaacccag
ccagcgccatctcaggaatggatctgtccctgcccccaggaattcgtccagcggatccag
aaggaggaagcaaaggagatctattccatccgggacaaggcgacgcgaacccgcctggcc
ctcatcatctgtaatgttgagtttgaccatctgcgcaggagggacggggctgacgtggac
atgaatgggatgaagaggcttctagaagggctgggatacaaggtggaaatccactgcaac
ttaaatgcccaggccatggtggagaccctgaagcagtttgctgctcggaacgagcaccgg
acctcggatagcaccttcctcgtgctcatgtctcatggcgtcagggctggcctgtgcggg
acaaattgccaagacgagtccacagacatccttcccattgacaccatctacagcaccttc
aacaacaggaactgccaggcactgctggaaaaacccaaagtgatcatcattcaggcctgc
cgtggggagaaccacggacaggtgtgggtgagtgactctgcagagctcccgggagatggc
tccagccttgctccgctgccccctgaagggttagaagatgatgcaagtcaccaaatccac
gtggagagcgatttcatctgtttccaagctacaacgccagacactttgtcctggagatct
ccaaaaactggctccgtcttcatcacctccctgatagagcagctccgaaccaatgcctgg
cgcctccccttggaggagatcttccgaaaggtccagctctcttttcaaaattttcctcgt
cagatgcccacaaaggaaagaacaaccatgataaaaaagttctatctgttcccaggccat
tag

DBGET integrated database retrieval system