KEGG   Croceicoccus naphthovorans: AB433_00885
Entry
AB433_00885       CDS       T03964                                 

Definition
(GenBank) 3-isopropylmalate dehydratase
  KO
K01704  3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
cna  Croceicoccus naphthovorans
Pathway
cna00290  Valine, leucine and isoleucine biosynthesis
cna00660  C5-Branched dibasic acid metabolism
cna01100  Metabolic pathways
cna01110  Biosynthesis of secondary metabolites
cna01210  2-Oxocarboxylic acid metabolism
cna01230  Biosynthesis of amino acids
Module
cna_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:cna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    AB433_00885
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    AB433_00885
Enzymes [BR:cna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     AB433_00885
    4.2.1.35  (R)-2-methylmalate dehydratase
     AB433_00885
SSDB
Motif
Pfam: Aconitase_C
Other DBs
NCBI-ProteinID: AKM08859
UniProt: A0A0G3XE26
LinkDB
Position
169162..169758
AA seq 198 aa
MEPIRTIEGRAIPFGAKNVDTDVIIPAHWLKTITREGMGRGAFETIRKDPDNLFDSERYK
NAPILIAGDNFGCGSSREHAAWALLDLGIKAVIAPSFSDIFSGNAFKNGILTVALPQEQI
DRLMEVAAEDDVHIDLEAQSVTTPFQDRFTFEIDPFRKHCLLEGLDEVGLTMARDEAISA
YEAKAASELPFLSGRLAA
NT seq 597 nt   +upstreamnt  +downstreamnt
atggaaccgatccgcaccatcgaaggccgcgccatcccgttcggcgcgaagaacgttgat
accgacgtcatcatcccggcccactggctgaagaccatcacgcgcgaaggcatgggccgc
ggtgcgttcgaaacgatccgcaaggacccggacaacctgttcgattccgaacgctataaa
aacgcgccgatcctgattgcgggcgacaatttcggctgcgggtccagccgcgaacacgcc
gcatgggccttgctcgatcttggcatcaaggccgttatcgcgcccagcttttccgacatt
ttttcgggcaacgccttcaagaatggcatcctgaccgtcgcgctgccgcaggaacagatc
gatcgcttgatggaagtcgccgcagaggacgacgttcacatcgacctcgaggcacagagc
gttacgaccccgtttcaggaccgcttcacgttcgagatcgacccgttccgcaagcattgc
ctgctcgaaggcctcgacgaagtcggcctgacgatggcgcgtgacgaggcgatttcagcc
tatgaagcgaaggccgcatccgaactcccgtttctctccggtcgccttgcggcctga

DBGET integrated database retrieval system