KEGG   Croceicoccus naphthovorans: AB433_02115Help
Entry
AB433_02115       CDS       T03964                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cna  Croceicoccus naphthovorans
Brite
KEGG Orthology (KO) [BR:cna00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AB433_02115
Enzymes [BR:cna01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AB433_02115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored K_oxygenase Thi4 AlaDh_PNT_C NAD_binding_8 FMO-like DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AKM09036
UniProt: A0A0G3XEJ8
LinkDB All DBs
Position
complement(416569..418182)
Genome map
AA seq 537 aa AA seqDB search
MLDANLKQQLQQYLGMLREPIELVASLGDGQKSDETRELLTMIADMSDKVTASFDGDNVR
LPSFLIRRAGDHDVAVTFAGLPLGHEFTSLVLALLWAGGHPPKVDERLVEQAKALGGTHN
FEMYFSLSCHNCPDVVQALTLLSLFNKGVSATLIEGGTFKDEVEERGVLAVPAVFKEGEM
WASGRMGLEEILAKVDTGAADRVAEEMQGMAPFETLVVGGGPAGSAASIYMARKGFRTGI
AADRIGGQVLDTMGIENFISTIYTEGPKLSAQMEAHISEYDIDVVKPVRASKLIPADKPG
EYHTVEFENGGTLSARSIVLSTGARWRSLGVPGEAEYQTKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLANIVGHVTLIEFDSKLRADQVLVDKLKSFANVDIHVSAQTTEITGD
GSKVNGLIYKNRESGDEHTIPLEGVFVQIGLVPNTEWLKDSGIALSKHGEIEIDDRAATN
LPGIFAAGDATTVPYKQIIIAMGEGSKAALSAFDYLIRTEPAAEIAQAAATHEAQVA
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaacctgaaacagcagctgcaacagtacctcggcatgctgcgcgagccg
atcgaactcgtcgcctcgcttggtgacgggcagaaatcggacgagacccgcgaactgctg
accatgatcgccgacatgtcggacaaggtcaccgccagcttcgacggcgataatgtgagg
ctgcccagcttcctgatccgccgcgccggtgaccacgatgttgccgtgaccttcgcgggc
cttccgctgggccacgaattcacctcgctcgtcctcgccctgctctgggccggtgggcat
ccgccaaaggtagacgaaaggctggtcgaacaggcgaaggcactgggcggcacgcacaat
ttcgagatgtatttctcgctatcctgccacaactgccccgacgttgtgcaggcactgacg
ctgctcagcctgttcaacaagggcgtgtccgcgaccctgatcgaaggcggcacgttcaag
gacgaggtcgaggaacgcggtgttctggctgttcccgccgtcttcaaggaaggcgaaatg
tgggccagcgggcgcatgggtctggaagagattctggccaaggtagacaccggcgccgcc
gatcgcgtggccgaagaaatgcagggcatggccccgttcgaaacgttggtcgtcggcggc
ggtcccgccggatcggctgcgtcgatctatatggcgcgcaagggctttcgcacgggcatc
gccgccgaccgcatcggtgggcaggtgctggacacgatggggatcgagaacttcatctcc
accatctacaccgagggtcccaagctctcggcacagatggaggcgcatattagcgaatac
gacatcgacgtcgtgaagccggtgcgtgccagcaagctgatcccggcggacaagcccggc
gaataccacaccgtcgagtttgagaacggcggcacgctgagtgcacgcagcatcgtgctg
tcgacgggcgcccgctggcgttcgctgggcgtgcccggagaggctgagtaccagacgaag
ggcgtggcctattgcccgcactgcgacggcccgctgttcaagggcaagcgcgttgcggtg
atcggcgggggaaactccggcgtcgaagcggcgatcgaccttgccaacatcgtcggccac
gtcacgctgatcgagttcgacagcaagctgcgcgccgatcaggtgctggtcgacaagttg
aagagctttgccaacgtcgacatccacgtctcggcccagacgaccgagattaccggcgac
ggcagcaaggtgaatggcctgatctacaagaaccgcgagagcggcgatgagcacacgatc
ccgctggaaggcgtgttcgtgcagatcggccttgttcccaataccgagtggttgaaagac
agcggcatcgccttgtcgaagcacggcgagatcgagatcgacgaccgtgcggcgaccaac
ctgccgggcattttcgcggcgggcgatgcgacgacggtgccttacaaacagatcatcatc
gcaatgggcgaaggatcgaaggcggcactttcggcgttcgactacttgatccgcaccgaa
ccggctgcggaaatcgcgcaggccgcggcgacgcatgaggcgcaggtggcgtga

DBGET integrated database retrieval system