KEGG   Croceicoccus naphthovorans: AB433_02910Help
Entry
AB433_02910       CDS       T03964                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cna  Croceicoccus naphthovorans
Pathway
cna00620  Pyruvate metabolism
cna00680  Methane metabolism
cna01100  Metabolic pathways
cna01120  Microbial metabolism in diverse environments
cna01200  Carbon metabolism
Module
cna_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AB433_02910
  09102 Energy metabolism
   00680 Methane metabolism
    AB433_02910
Enzymes [BR:cna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AB433_02910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AKM09159
UniProt: A0A0G3XEY5
LinkDB All DBs
Position
complement(575269..578052)
Genome map
AA seq 927 aa AA seqDB search
MNPKIAALHDRLRDLHGRTRETPLFNPVFQLGLEFSRDLESGDSSLADIDALVSALECEG
LLARAQKLDRMLAPMAAAENLASFESDEDEFEAFAARWSNPMLHVVFTAHPTFLLTPAQA
ASVAEGATEGRVDGDHVCSAPYERTQITLDSEHDAAMAAMSRAQGARDRIVRGLFETAQS
KWPGAWKQFAPVPVRLATWVGYDMDGRTDIGWNTSIRYRLAEKSERLASYAAMLAEDAPD
VAARLAAAAEHTGEMAANFAKDLSDPALLGHAANSLTADHPDKLTGLAPIIDELAKLAAD
ADDATATTLLTAAAAMRADGLGMGWIHFRVNSSQLQNAIRRRVDPESRLDLSSQAALSAI
RTALREAVPLKANFAALAIESSTAIRQFLAMQQILKHIDADAPIRMLIAECEQPQTVLAA
LYFAKLFGIDDKVDVSPLFETETALEHGGRFLDALLAEEDYRDYARVRGRVAIQTGFSDA
GRFVGQIPASLAIERLQGRLADAMKANGLTDVAALIFNTHGESMGRGAHPASMKDRMEWP
LSPWARRRFVRAGIRLEPEVSFQGGDGYLWFGTPELALATLTRIAENAPGVTDPDAPTDQ
FYRRTDLSLDFYRAIRRVQNMHLVSATYSRAITAFGLGLLNDTGSRRSRRQSDLSADRKM
SLRQIRAIPHNAILQQLGYPVNVIAGFGTAAENNVEEIANLLATSARGQQLLRLVRAADA
LASIKTVAAYGELFNSAYWASRPYRGTEKHLTDACLTLAAYLTKDDRVGVFRRLASRLRV
DAMHLHKLLDAIPGGKEEWGLPLPDREHKRRSIGVLQALRLALLQHMFLKAVQVPVFSRS
NDVSREDVLEMVFTLRIDDALSQLRRAFPTSFPGIDDFDVDEASDYPDGGDSGYLAIRRD
FIDPIEQAYALVLRIGTAIANEFGAHG
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgaagattgccgccctgcacgaccgccttcgcgaccttcatggcaggacgcgg
gaaaccccgctgttcaatccggtgttccagctgggtctggaattttcgcgcgatctggaa
tcgggcgatagctctctggccgacatcgatgcactggtcagcgcgctggagtgtgaaggc
ctgctggcccgcgcgcaaaagctggaccggatgctggccccaatggccgcggcggagaac
cttgcctcgttcgagagcgacgaggatgaattcgaagccttcgccgcgcgctggtcgaac
ccgatgctgcacgtggtcttcaccgcgcacccgactttcctgctgactccggcacaggcg
gccagcgtggcagaaggcgcgaccgaggggcgcgttgacggcgatcacgtctgctccgcc
ccgtacgaacgcacgcagatcacgctggacagcgagcacgatgcggcgatggcggcgatg
agccgcgcgcagggtgcacgcgaccgcatcgtgcgcggcctctttgaaaccgcacagagc
aagtggccgggcgcgtggaagcagttcgcgccggtgccggtgcggctggcaacctgggtc
ggttacgacatggacgggcggaccgacatcggctggaacacctccatccgctatcgcttg
gccgaaaagagcgagcgtctggccagctatgccgcgatgctggccgaggacgcgccggat
gtcgccgcgcgccttgccgccgctgccgagcataccggcgaaatggccgcgaatttcgcg
aaagacctgtcggacccggcgctgctgggccacgcggcgaattcgctgaccgccgatcac
ccggacaagctgaccggccttgccccgatcatcgacgagctggcgaaactggcagcagac
gccgacgatgcgaccgcgaccaccctgctgaccgccgctgcggcgatgcgcgctgacggc
ctcggcatgggctggatccacttccgggtgaactccagccaattgcagaacgcgatccgc
cgccgggtcgacccggaatcaaggctcgacctgtcgagccaggccgcgctgtcggccatc
cgcacggccctgcgcgaagcggtgccgctgaaggccaacttcgccgcgctggccatcgaa
tccagcaccgcgatccggcaatttttggcgatgcagcagatcctgaagcatatcgacgcc
gacgcgccgatccgcatgctgatcgccgaatgcgaacagccgcagacggtgctcgccgcg
ctctatttcgcgaagctgttcggcatcgacgacaaagttgacgtctcacccctgtttgag
acggaaaccgcgctggaacacggcggccgtttcctcgacgcgctgctggcagaggaagac
tatcgcgattacgcgcgcgttcgcggccgggtcgcgatccagaccggcttttccgacgca
ggccgcttcgtcgggcaaatcccggccagccttgccatcgaacgcctgcagggccgcctt
gccgatgcgatgaaggccaacgggctgacggacgtggccgcgctgatcttcaacacccac
ggcgaatcgatgggccgcggtgcgcatccggccagcatgaaagaccggatggaatggccg
ctgtccccctgggcgcgccgccgcttcgtgcgcgcagggatcaggctggagccggaggtc
agctttcagggcggcgacggatacctgtggttcggcacccccgaactggcactggcaacg
ctgacccgcattgccgaaaatgcgccgggggtcaccgatccagatgcgccgacggaccag
ttctatcgccgcaccgacctttccctcgatttctatcgcgcgatccggcgcgtgcagaac
atgcacctcgtctccgccacctacagccgcgcgattactgcattcgggctcggcctgctg
aacgataccggcagccgccgttcgcgccgccagtccgacctgtcggcggatcgcaagatg
tccttgcggcagattcgcgcgatcccgcataacgcgatcctgcagcaactgggctatccg
gttaacgtgatcgccgggttcggcaccgcggcggaaaacaacgtcgaggaaatcgccaac
ctgctggcgacaagcgcgcgggggcagcagttgctccgcctcgtccgcgccgccgatgcg
ttggccagcatcaagacggtggctgcctatggcgaactgttcaactccgcctactgggcc
agccggccctatcgcggcaccgaaaagcacctgaccgatgcctgcctgacactggcggca
tacctcaccaaggacgaccgggtcggcgtctttcgccggcttgccagccgcttgcgcgtc
gatgcgatgcacttgcacaagctgctggatgcgatccccggcgggaaagaggaatggggc
cttccgctgccggatcgggagcataagcgccggtccatcggcgtgcttcaggcgctgcgc
ctagcgctgttgcagcacatgttcctgaaggccgtgcaagtcccggtcttctcgcgcagc
aacgacgtcagccgcgaagacgtgttggaaatggtcttcaccctgaggatcgatgacgcg
ctgtcacagttgcgccgcgccttcccgaccagcttccccggcatcgacgatttcgacgtg
gacgaggccagcgattatccggacggcggcgacagcggctatctggcgatccggcgcgac
ttcattgatccgatcgaacaggcctatgcactcgtcctgcgcatcggtacggccatcgcc
aacgagttcggcgcgcacggctga

DBGET integrated database retrieval system