KEGG   Croceicoccus naphthovorans: AB433_09865Help
Entry
AB433_09865       CDS       T03964                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cna  Croceicoccus naphthovorans
Pathway
cna03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cna00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AB433_09865
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cna03400]
    AB433_09865
Enzymes [BR:cna01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AB433_09865
DNA repair and recombination proteins [BR:cna03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AB433_09865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AKM10204
UniProt: A0A0G3XHX8
LinkDB All DBs
Position
1963389..1965920
Genome map
AA seq 843 aa AA seqDB search
MTKTRSAPDPLAEYNARRNFAKTAEPAGKRGRAREGAEGGRFIVQKHDATRLHWDLRLEA
DGVLKSWAVTKGPSPDPDIKRLAVRTEDHPMSYAEFEGVIAKGEYGGGTVMLWDKGTWAP
IAGKSWRDIDDGHLHFTLNGERMKGEWLLIRLKPRKGEKRENWLLRKIRDDHAEDGDPLI
QHELTSVLTGRSMAEIAADKQGRYSLAGKKDADFAAQMAKAADRNEAKAKPRKRRAAGQP
KFRKPQLATLVDAVPAGNGWMHEIKFDGYRAMIAAAGNKVTVWTRSGKDWTDKFGPLVDA
LAALDLPPCLIDGEIVAYDRGGNPDFSTLQAVLKRGHGSQGVGDKLGLHCFDLLEIDGED
ITARPNIERKERLEALLAHAEPPILVADHVIGAGEKLYDTMCKAGQEGIIAKRIDAPYRS
SRTKNWVKVKCTRRQEFVLIGWKKSSAKGRPFASLLLAQSEGDALVYKGNVGTGFSADAM
DDLAAKMARIERKTPPAEVDKASARGVTWLTPKLVAEIAFAEFTADGNLRHASFLGLRSD
KDANAVKPEQASAAPKEDAVEISSRDRIIFPDIGQTKGQLADYYTAIAPLMLPFAAQRPV
SLVRCPQGRAKKCFFQKHDSGSFGPHVHHVPIREKDGGTEDYLYIEDTAGLLACVQMGTI
EFHGWAARSDDVEAPDRMIFDLDPDEGLNFDAVKKAARDIRDRLADLGLVSFAMLSGGKG
VHVIVPLEPDHSWDAHKDFARRFAEALSMAEPDRFTATMSKAKRKGKIFIDWLRNQRGST
AVAPYSARARPGAPVAVPVAWNELRDTDNAHPFSIDDADKLLKRARSKALHGWGMAAQRL
PDV
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaaaaccaggtctgcccctgacccgctggccgaatacaacgcccggcgcaatttt
gcgaaaacggccgaaccggcaggcaagcgcggcagggcgcgggaaggtgcagagggcgga
cgctttatcgtgcagaagcacgacgccacacggcttcactgggacttgcggctggaggcg
gacggcgtcctgaaaagctgggccgtcaccaagggcccctcgcccgatcccgatatcaaa
cggttggctgtgcgaaccgaggatcacccgatgtcctacgccgagttcgaaggcgtgatc
gccaagggcgaatacggtggcggcacggtgatgctgtgggacaagggcacctgggctccg
atcgctggcaagtcgtggcgcgacatcgacgatggccacctgcacttcacgctgaatggc
gagcgaatgaaaggcgaatggctgctaatccgcttgaaaccgcgcaagggcgagaaacgc
gagaactggctgctgcgcaagatacgggacgatcatgccgaagacggcgatcccctgatc
cagcacgaattgaccagcgtgctgacggggcgatcaatggcggagatcgcggccgacaag
cagggcaggtactcgctggcgggaaagaaagacgcggacttcgcggcgcagatggccaaa
gccgccgaccgcaacgaagccaaggcgaagccccgcaagcgcagggcggctggccagccg
aaattccgcaagccgcagcttgccacgctggtcgatgcggtgcccgccgggaacggctgg
atgcacgagatcaagttcgacgggtatcgcgcgatgattgcggcggcaggtaacaaggtt
accgtctggactcgcagcggcaaggactggaccgacaagttcgggccgctggtagacgca
ctggccgcgctggacctgccgccctgcctcatcgatggcgagatcgtcgcttacgacagg
ggcggcaaccccgacttttccactctgcaggccgtgctaaagcgcggacacggatcgcaa
ggcgttggcgataagctaggcctgcattgtttcgacctgctggagattgacggcgaggac
ataactgcgcgccccaatatcgaacgcaaggaaaggctggaggccctgctggcccacgct
gagccaccgatcctcgtggccgatcacgtcatcggtgctggcgaaaagctttacgacacg
atgtgtaaagccggtcaggaaggcatcatcgcaaagcggatcgacgcgccctatcggtca
tcgcggacgaagaactgggtgaaagtgaaatgcacccggcggcaggaattcgtcctgatc
ggctggaagaaatccagcgccaagggccgtcctttcgcctcgctgctgctggcacagagc
gagggcgatgcgctggtttacaagggcaatgtcggcacggggtttagcgccgacgcgatg
gacgatctcgccgcgaaaatggcgcggatcgagcgcaagacaccgcccgccgaagtcgac
aaggccagcgcgcgcggggtcacgtggctgacgccgaaactggtcgcggaaatcgcattc
gccgagttcactgccgacgggaatttgcgccacgccagcttcctcggcctgcgtagcgac
aaggatgcgaatgcagtgaaacccgagcaggctagcgcggcgcccaaagaagacgccgtc
gaaatctccagccgtgaccgtattatcttccccgacattggccagacaaaggggcaactg
gccgactactacacggccatcgcacccctgatgctgcccttcgccgcgcaacgtccggtc
agccttgtccgctgtccgcaagggcgcgcgaagaaatgcttcttccagaaacacgacagc
ggatcgttcggcccgcacgttcaccacgtgccgatccgagaaaaggacggcggaacggaa
gactacctctacatcgaggacaccgccggactgctcgcctgtgtgcagatgggcacgatc
gagtttcacggctgggccgcgcgcagcgacgatgtcgaagcgcccgatcgcatgatcttc
gatctcgaccctgacgaggggctcaacttcgacgcagtgaaaaaagccgcccgcgacatc
cgcgaccgattggccgatctgggccttgtcagttttgccatgctctcgggcggcaaaggc
gtgcacgtcattgtcccgttggaacccgaccattcgtgggacgcgcacaaggacttcgcc
cgccgttttgccgaggcgctgtccatggccgaaccggaccgctttacggcaacgatgagc
aaggccaagcgcaagggcaaaatcttcatcgactggctccgcaaccagcgcggcagtacc
gccgtggcgccctactccgcccgcgctcgacccggcgcgcccgtcgcggtaccggtcgcg
tggaatgaattacgcgatacggacaatgcccacccgttcagcatcgatgatgcagacaaa
ctgctgaaacgcgcgcgatcgaaggcgctgcacggctggggcatggcggcgcagcgcctg
cccgacgtttag

DBGET integrated database retrieval system