KEGG   Croceicoccus naphthovorans: AB433_12645Help
Entry
AB433_12645       CDS       T03964                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cna  Croceicoccus naphthovorans
Brite
Enzymes [BR:cna01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AB433_12645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AKM10618
UniProt: A0A0G3XJT1
LinkDB All DBs
Position
complement(2506787..2507506)
Genome map
AA seq 239 aa AA seqDB search
MSKVTRREAIGTAAVGVAGVALAGGASSTATAQETARSLAFAGNHTPKPLRFNPASLTGL
SERLITSHWENNYQGSVRGLNTIETRLAAAMADPDFPTVAFAGLKREELHRTGSVVLHEI
YFDGLGGNGEAGGSVRDALSTAYGGFDAWEAEFRRTAMSLAGGSGWCVLTWNAHTQSLHN
YWAWDHMHGAVTGAPLIALDMYEHSYHMDYGTAAARYIDAFMANLDWEVIDTRYRAAIA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggtcacacgccgtgaggcaatcgggacggcggcggtgggagtcgcaggtgtt
gcccttgcgggcggagcatcgtccacggcaaccgctcaggagaccgcgcgaagccttgcc
ttcgcgggcaatcacacacctaaaccactgcgcttcaaccccgcaagcctgacgggattg
tccgaacgcctcatcacctcacactgggagaacaattaccaaggctcggtgcggggcctg
aacactatcgaaacccggcttgccgccgcgatggctgatcccgattttccgaccgtggcc
tttgccggattgaagcgtgaggaactgcaccgaacggggtcggtagtgctgcacgaaatc
tacttcgatgggctgggcggaaacggtgaggcaggcggatcggtccgcgatgcgctctcc
actgcgtatggcggcttcgatgcttgggaagccgagttccgccgcactgccatgtctctt
gctggcggatcaggctggtgcgtgctcacctggaatgcgcacacccagtcgctgcacaat
tactgggcctgggatcacatgcatggtgcagtgacgggcgctccgctgatcgcgctcgat
atgtatgagcactcctatcacatggactacgggacagctgccgcgcgctatatcgatgcc
ttcatggccaatctcgactgggaagtgatcgacacgcgctatcgcgcggctattgcctag

DBGET integrated database retrieval system