KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBA3650Help
Entry
CNBA3650          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb04113  Meiosis - yeast
cnb04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    CNBA3650
  09143 Cell growth and death
   04113 Meiosis - yeast
    CNBA3650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cnb01001]
    CNBA3650
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cnb03019]
    CNBA3650
   03036 Chromosome and associated proteins [BR:cnb03036]
    CNBA3650
Enzymes [BR:cnb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CNBA3650
Protein kinases [BR:cnb01001]
 Serine/threonine kinases: AGC group
  PKA family
   CNBA3650
Messenger RNA biogenesis [BR:cnb03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CNBA3650
Chromosome and associated proteins [BR:cnb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    CNBA3650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 4933623
NCBI-ProteinID: XP_777896
UniProt: Q55ZX5
LinkDB All DBs
Position
1
AA seq 516 aa AA seqDB search
MFQKVSDKFHRKQQSTTLPGKTQQVPNPTSPVLAKANSQAQQAYSLPQDHSPMEGIQRDS
PPIQQPMATEKAPIVGSSASTSLPTLSVQDGTLPLTPGAQGMQTGTIDGHRQLQSPVSRS
SSAGEDKMREKARDAQEQAAQAQANLHHATQQARVAAINAAATQAALETAAQLPATARVP
VSGGGVEQGQARRKTAGRYALSDFLIERTLGTGSFGRVHLVRSRHNGRFYAVKVLNKEKV
IKMKQVEHTNSEREMLVRVRHPFLVNLWGTFQDVNNLYMVMDFVAGGELFSLLRKSQRFP
NSVAKFYAAEVALALDYLHSLDIIYRDLKPENLLLGADGHVKVTDFGFAKYVPDITWTLC
GTPDYLAPEVVQSKGYNKSVDWYALGVLIFEMLAGYPPFFTEDGNPMKLYEKIIAGKVRY
PTYFDALAKELLKNLLIGDLTKRYGNLRAGSSDIFAHGWFAEVDWDKLYRREIPAPYVPK
IDGEGDASQFDRYQEADVSAYGKVGNGPYDHFFTEF
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttccaaaaggtgtccgataagttccatcgcaaacagcagtccacgacattacccggt
aaaacgcaacaggttcctaaccctaccagtccagtcctggcgaaagccaattctcaagct
caacaagcatattctttgcctcaagatcattccccgatggaaggtatacaaagggattcc
ccccctatccaacagcctatggctactgaaaaggcacccatagttggatcttctgcatcg
acgtctttacccaccctatccgtgcaagatggcactcttccattgactccaggtgctcag
gggatgcagacaggcacaattgacgggcatcggcaacttcagagtcctgtgtctcgtagt
agtagtgcaggcgaggataagatgagagaaaaggcgagggatgcccaggagcaggcagcg
caagcccaggccaacctccatcacgcaacgcaacaagcgcgcgttgccgccatcaatgcc
gccgctactcaagctgcccttgaaacagccgcccagctgcccgcaactgctagggtccca
gtttccggtgggggagttgagcagggtcaagcaagacgcaaaacagctggccgatatgct
ctatctgatttccttattgaaagaactttgggcaccgggtccttcggacgtgtgcattta
gtgcggtcacgccacaacggtcgcttctatgccgttaaggttctgaacaaggagaaggtt
atcaagatgaagcaagttgaacacaccaattctgaacgagagatgttggtgcgggttcga
cacccatttctcgtcaacctctggggaacctttcaggatgtgaataacctgtatatggtc
atggactttgtggcaggaggtgaactctttagccttcttcgtaaaagtcaacgattcccg
aattctgtcgcgaaattctacgcggccgaagttgctttagcgctcgactatcttcattca
ctcgatattatctaccgagatcttaagccagaaaatctacttttgggtgcagatggccat
gtcaaggttaccgactttggttttgccaagtatgtacctgatatcacctggactctttgc
gggacaccggattaccttgctccggaggttgttcagtccaagggttataacaaaagcgtc
gattggtacgctttaggggtattaatatttgaaatgctggcgggttatcctcccttcttc
accgaagacggcaatccaatgaaattgtatgagaagatcattgctggcaaagtccgctat
ccgacatactttgacgcacttgcgaaagaactcttaaaaaatctactgatcggggacctc
actaagcgatacggtaatttgagagcgggctcttctgatatatttgcccatgggtggttc
gcagaagtcgactgggacaagctgtacaggcgcgaaatcccggctccatatgtgcccaag
attgacggcgaaggagacgctagccagttcgatcgctaccaagaggcggatgttagtgct
tatgggaaggttggcaacggtccatatgatcatttcttcacggagttttag

DBGET integrated database retrieval system