KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBA5310Help
Entry
CNBA5310          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb03030  DNA replication
cnb03410  Base excision repair
cnb03420  Nucleotide excision repair
cnb03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CNBA5310
   03410 Base excision repair
    CNBA5310
   03420 Nucleotide excision repair
    CNBA5310
   03430 Mismatch repair
    CNBA5310
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cnb03032]
    CNBA5310
   03400 DNA repair and recombination proteins [BR:cnb03400]
    CNBA5310
Enzymes [BR:cnb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CNBA5310
    6.5.1.6  DNA ligase (ATP or NAD+)
     CNBA5310
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CNBA5310
DNA replication proteins [BR:cnb03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CNBA5310
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CNBA5310
DNA repair and recombination proteins [BR:cnb03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CNBA5310
   NER (nucleotide excision repair)
    Other NER factors
     CNBA5310
   MMR (mismatch exicision repair)
    Other MMR factors
     CNBA5310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_N DNA_ligase_A_M DNA_ligase_A_C CAF1-p150_N
Motif
Other DBs
NCBI-GeneID: 4933794
NCBI-ProteinID: XP_777834
UniProt: F5HGK7
LinkDB All DBs
Position
1
AA seq 944 aa AA seqDB search
MPADSKVKRGAKPQATPITPPSKKFKQAAVTQQRPISSFFHSPVKSSIKGKEVIIIEDSD
SDDYPESSTQAAIAHDGNGDVESSRNHVLQLPEENQISSLSCVKEKDGHGMASTSKVFHE
RSKTTPNGTAISSRTEGQSDRVHYFSRKSQRTITGDEPVPPSSITTCASEDSVQNIDFDR
DPLAFDPSRVIATSWPKGRLPYSILVSVYVQLSSTKSRLAIVRILTNFLHLLMHTSPPDL
TPCLYLLSNHLTPSYIHCDLGIGSSILSKSIQEISGLQARDLKHLWQKYGDPGDVAFEAK
NKLRTLVQPAPLLAGEVYDKLLEIAKVKGSNSGKIKNELVRKLLIRAKGEEVRFLVRSIV
GNLRIGAVRLTLLTALARATTITRLPADLKQSIIPLPRATANDGRNDKRSVITKAPPDVA
RDSAETLCLDAIRIVRKVYVRHPNYEDLVAGLKEGVESLEDKVPVSVGIPLSPMLGSITR
SLNEVFTRLGHLSFTAEAKLDGQRGQLHIRLDGPEGKDDGGGRWVYADNGTKVWVRLFSR
HLEDMTDKYPDICHLALDLLSRPLATERPPFPAVSSRPFSRVIDLLHINNITSVVMDTEI
VALDKDTGNFRTFQELSNRAKKDVKMEEIKVIVGVFAFDLMVLNDVSLLDVPFSHRRHLL
HSLLPPFAPNSNEVGHPVARFTHVEYIDSVHLTDPEAELQAFFERVVEKKCEGLMVKLLE
NGEGLAGEEATEDSLGQEGGLEVKSEQKNGSKSKRQPLPATYEPDQRSQGWLKVKKDYLE
GLGDSLDLVPIGAWWGQGRKAGWWSPILLACHNPDSGALEAVCKCMSGFSDAFYKDLSKR
YPAEGMPSKCSKIAPIGFVNTNGLIPDVWFEPSEVWEIKGADITLSPVYPAASSHLGSER
GLSVRFPRFIRMRDDKTWEDAMTSDQLADMYRRQIKEGEKTTKN
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctgacagcaaagtcaaaaggggagcgaaaccacaggcaacacccatcacaccg
cccagtaagaaattcaagcaagcggctgtcacccaacaacgtcccatatcctcttttttt
cactcacctgttaaaagcagcatcaagggcaaggaggtcattatcatagaagattcagat
tcagatgattatcctgagtcctcaacccaggcggcgatagcacatgacgggaatggtgat
gtggaatcatccagaaaccatgttcttcaactacctgaagagaatcagataagctccctc
agctgtgtaaaggagaaagatggacatggtatggccagtacttcaaaagtttttcatgaa
agatcgaagacaacgcccaatgggacggctatctcgtcacgaacggaaggacaaagtgat
cgagtgcactacttctcccgaaaatcccagagaacaataactggggacgaacctgttcct
ccctccagtatcactacttgtgcttcagaagactcggttcaaaatatagattttgatcgc
gaccctctcgccttcgatccgtcccgggttatagcaacttcctggcccaagggtcgttta
ccgtacagtattctcgtcagcgtgtatgtacagctctccagtacaaagtcgcgattagct
atcgtacgaatcttaacaaacttccttcatttgctcatgcacacttcaccacctgatttg
acaccttgcctttatctcctttccaatcaccttaccccttcctacatccattgtgatctt
ggcattggatcttctatattgtccaaaagtatacaagaaatttcgggccttcaagctcgc
gatctcaaacacctatggcaaaaatatggcgatcctggcgatgttgctttcgaagcgaaa
aacaaactacgaactttggtgcaaccagctccgcttttggctggagaagtgtatgataag
ttgctggaaattgcgaaagtgaagggcagtaatagcgggaaaataaaaaatgagctagtc
agaaagttgttgattcgggccaaaggagaggaagtcagatttcttgtccgaagtatagta
ggcaacttgaggataggtgccgtcaggctgacccttctgaccgccttggcacgcgccacc
actataacacggcttccagctgaccttaagcagtctataataccccttccaagggctaca
gccaacgatggcaggaatgataaacgctcagtcattactaaagcacctccagacgttgcc
cgcgattccgcagagactctctgtctagatgccatacgcatagtacggaaagtgtatgta
cgacatccaaattacgaagatcttgtagccggcctcaaggaaggagttgaaagtttggag
gataaagtgcctgtgagcgtagggattccactgtctcccatgctggggtccatcacaaga
tcactgaacgaggtgttcacgagactgggacatctttcgtttacagcagaggcgaagtta
gatggtcagagaggacaacttcatatcagactggatggcccggaaggaaaagatgatgga
ggggggagatgggtttatgcggataatggtactaaagtttgggttaggctattcagcagg
cacttggaagacatgaccgacaagtaccccgatatctgtcacctagctcttgatcttctc
tcgcgaccccttgcaacagaaaggccgccattcccagccgtttccagtcgaccattttca
agagtcatcgatttactacacatcaataatatcacatcagtggttatggataccgagatt
gtagcactggacaaggataccggtaactttcgaacctttcaagaactgtctaacagagcg
aaaaaagacgtgaaaatggaggaaattaaagttatagttggggtctttgcttttgattta
atggtgctcaatgatgtctcattactggacgtccctttttcacatcggagacatctcctt
cacagtctgctcccccctttcgctcccaattcaaatgaagttggacacccagtggcacgt
ttcacacatgtcgaatacattgattctgtccatctcactgatcctgaggcggaattgcaa
gcattcttcgagagggttgtggaaaaaaagtgcgaaggcttgatggtcaaattgctggaa
aacggggaaggcttggctggggaagaggcgacagaagatagtttaggtcaagaagggggc
ctggaagttaagtcggagcagaagaatgggagtaagagtaagcgtcaacctcttcccgct
acatacgagccagatcagcgcagtcaaggttggctcaaggtaaagaaagattatctagaa
gggttaggggattctctcgatctcgtgcccattggcgcgtggtggggtcagggccgtaaa
gcgggttggtggagtcctattctcttagcctgccacaatcctgatagtggcgccctggaa
gcggtctgcaaatgcatgtccgggttttctgacgcattctacaaagatcttagcaagcgc
tatcctgccgaaggaatgccgagtaaatgcagcaaaatagcacctattggatttgtaaat
acgaacggcttaataccagacgtgtggtttgagcctagcgaagtatgggagattaaaggt
gctgacatcaccctctctccggtctatccggcggcttcatcgcatcttggatctgaaaga
gggttgagtgtccgattccctcgtttcatacgcatgcgagacgacaagacatgggaggac
gctatgacaagtgatcagcttgccgatatgtacagacgccagataaaagaaggcgagaag
acaaccaaaaactag

DBGET integrated database retrieval system