KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBA6200Help
Entry
CNBA6200          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cnb03036]
    CNBA6200
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CNBA6200
Chromosome and associated proteins [BR:cnb03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     CNBA6200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 4933884
NCBI-ProteinID: XP_777742
UniProt: Q55Z68
LinkDB All DBs
Position
1
AA seq 756 aa AA seqDB search
MSPADGPLGLFVQPACLQHRYIRHPNAAHVFERPERLRAVLLGVAAAVARLEQAAPAPQP
PHDLASLLSSLSLLSRAQPTAQLHLVPAPPPPPRPGSVLLHHPAVQLAHSPVPEAPFPYI
GPGSTGPSGAGFPSSGYLRDLVKWANEAAERIKQTGCEIPDGLGLNPGDLYLGPGSIVAI
EGAIQTVCQAVDHVVQKTKQVPAKEEPSTPPVEGPADALFTKAFCAIRPPGHHCGEDAPS
GFCYVNNVVIGALHGYLQHDIDRAIIIDFDLHHGNGTQALVMPLNAASYADDLQVKAGKP
PITGQGGRRRRGWKAFYGSVHDIYSYPCEDGDLDLIRDASISLAAHGQYIENIHLKPYSS
EADFYERIYPLYLALLDKAKVFMEQTEADPERTIVFISAGFDACEWEHQGMQRHDRRVPV
SFYSRYTRDIAAFADKYTEGKVVSVLEGGYSDRALTSAAMGHIVGMRGSLPEGCDEWWAE
KELISLEKATKKKRGGKLAPLPAEFASQPHLSRTHSLLAHFEGTTCTDSVGSTATNTPMG
TTRMTLRDRKKADESGAASIDNTPGYGGAKRGNRTRAAAGGVTPAPSKLKIPSQPTDTGT
FSVNPESNTVLPFHIDTAPTTDETLGAQSSVKTDVGGENEMGDWIEQAVKDMTKMSLGES
ASTPPVQESKSKSPSPPSIQTTPTTTSLPKIILRIPARPTTTTDTVERPDPVLPPQQSCQ
PRLDAETQARPPPLETVAYSPTATPTELLHHISGGH
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccgccgacggccccctcggcctcttcgtgcagcccgcctgtctccagcacagg
tacatccgccatccaaacgccgcccacgtattcgagcgcccagaacgcctccgcgccgtc
ctcctcggcgtcgctgctgccgtcgccaggctcgagcaggccgcacccgctccccagccg
ccacacgacctcgccagcctgctctcctccctctccctcctgtcccgcgcccagcccacc
gcccagctccacctcgtgcccgccccgcccccgccgcccaggccaggcagtgtcctgctg
caccacccggcagtccagctcgcccactcgcccgtccccgaggcgccctttccgtatatc
gggccagggtccacgggcccgtccggggcgggcttcccctcgtccggctaccttagggat
ctggtcaaatgggccaacgaggcggcggagagaatcaagcagacggggtgcgaaatacca
gacgggctgggactgaaccctggagatctttaccttggcccgggaagtatcgttgccatc
gagggcgctatccaaacggtctgccaagcggtagatcatgttgtgcaaaagacaaaacag
gtacctgcgaaggaggagccgtctacgccccccgttgagggtcctgcagatgcgctgttc
acgaaagcgttctgtgctataagaccacccggtcaccactgcggcgaagatgcaccctcg
gggttttgctatgtcaacaacgtggtcattggcgctctgcatggctacctccagcacgac
attgatcgcgcgattatcattgatttcgatctccaccacggtaacggcactcaagcgctc
gtcatgcccctcaacgcagcttcttatgcggatgatctacaggtcaaggctggaaagcca
ccgataacaggacaaggagggagaagaagaaggggctggaaggcattctatggatcggtg
catgacatttacagctacccgtgcgaggatggtgatcttgatctcattcgagacgcctca
atctctctagctgctcatgggcagtacatcgaaaacatccatcttaaaccatacagctcg
gaagccgatttctacgagcgaatctaccctctatatcttgcactcttggacaaggccaaa
gtatttatggaacagaccgaggccgacccagagagaaccattgttttcataagcgcagga
ttcgatgcttgtgaatgggaacatcaaggaatgcagcggcatgatcgccgagtacctgtt
tcgttctattcgaggtatacgcgtgatattgcggcttttgcggacaaatacacagagggc
aaggttgtctccgtgttggaaggcggttacagcgatcgagcattgacgagtgcagccatg
ggtcacattgtgggaatgagagggtctttgcctgaagggtgtgatgaatggtgggctgaa
aaagagttgatcagtctggaaaaggcaaccaaaaagaagagaggaggcaagcttgcccct
cttccagcagagtttgcttcacaaccacatctctcccgaacgcactctctcctcgcccat
tttgaagggacgacttgcacggattcagtggggagtacggctacaaatactcccatgggg
acgacgaggatgaccctgcgcgataggaaaaaggctgatgagtctggtgcagcgagcata
gataacacgcctggctacggtggggcgaaaaggggcaataggacaagggccgccgctggg
ggtgtgacgccggcaccatccaagctcaagatcccctcgcagcccactgatacaggcaca
ttttctgtgaatccagagagtaacactgtgctcccattccatatcgatacagcacccacc
acggatgagacgctcggcgcacaatcctctgtgaaaacggatgtgggcggagagaacgaa
atgggagactggattgaacaagctgtcaaagacatgacgaaaatgtcactgggagagagt
gcatccacaccaccggtacaggaatccaagtccaagtctccgtccccgccttccatccag
acgaccccaacgactacttcactacccaaaattatcctccgcattcccgcccgccctact
actactaccgatactgtcgaacgacccgaccccgttttaccaccccagcaatcatgccaa
ccccgtctcgatgccgaaacacaagctcgacccccgcctttagagactgttgcatacagt
cccaccgcgacccctaccgagcttttacatcacatctccggcggtcactag

DBGET integrated database retrieval system