KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBB4000Help
Entry
CNBB4000          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00020  Citrate cycle (TCA cycle)
cnb00310  Lysine degradation
cnb00380  Tryptophan metabolism
cnb01100  Metabolic pathways
cnb01110  Biosynthesis of secondary metabolites
cnb01130  Biosynthesis of antibiotics
cnb01200  Carbon metabolism
Module
cnb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cnb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CNBB4000
  09105 Amino acid metabolism
   00310 Lysine degradation
    CNBB4000
   00380 Tryptophan metabolism
    CNBB4000
Enzymes [BR:cnb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CNBB4000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 4934494
NCBI-ProteinID: XP_777169
UniProt: F5HB36
LinkDB All DBs
Position
2
AA seq 1055 aa AA seqDB search
MFRGRGLNDILLIGQFLKHPLSSAFIPFPTQLPAAMLRSIPKHIRIPSRSTAQPARAILS
LSAVQRHTQKRSYAAEAVAPSKNDAFANGGNAYYTEEMYRLWKQDPKSVHVSWQTYFSGL
DKGLPSAHAFTPPPGVLSGAVPTPAGGSPKLSVEGSGDVTDYLKVQLLIRAYQVRGHHIA
NLDPLRISGADLDGRVPPELKLDYYGWTEADMTKEFRLGDGILPRFMGQVKDDTMTLGQI
IDELKQMYCTHVGCQYVHIPDRGQCDWIRERVEIPTQWNYSTEEKRMILDRLMWSELFEK
FIASKYPNEKRFGLEGCESLIPGMKALIDRSVDAGVKSIVLGMPHRGRLNVLGNVIRKPI
EAILNEFKGNEDADDTGGGDVKYHLGANYIRPTPSGKKVSLSLVANPSHLEAEDPVVLGK
TRAIQHFEGDEGDGSSAMGVLLHGDAAFAGQGVVYETMGMQNLPNYGTGGTVHLIVNNQI
GFTTDPRFARSTPYPSDIAKSIDAPIFHVNSDDVEAVNYVCTLAADWRATFKKDVVIDIV
CYRRYGHNETDQPSFTQPKMYKAIQKQPTVLSIYTDKLIKEGTFTEKEIDEHRQWVWGML
EKAYDGSRDYKPSPREWLSSSWEGFPSPKELAEEVLPQHHTGASEDALKRVGQIISSFPE
GFHPHKNLARIIGNRGKTVAEGKNIDWSTAEALAFGTLCLEGTHVRISGQDVERGTFSQR
HAVVHDQKTEQTHIALKHLDADQGSFTVTNSHLSEFGTLGFELGYSLVSPNSLTIWEAQF
GDFANNAQCIIDQFIAAGERKWLQRTGLVLSLPHGYDGQGPEHSSGRIERFLQLCDDEPR
VYPSPEKLERQHQDCNMQVVYPTTPANYFHVLRRQNKRDFRKPLIVFFSKSLLRHPLARS
SLEEMSGDSKFQRYIPEPHPESLVEPEKIRRHILCTGQVYFQLLKEREERGINDVAISRI
EQLSPLPYDRLTPHLDKYPNADLVWAQEEPLNNGAWTYVQPRLITALQETEHHKSKIPFY
AGRKPSSSVATGSKYAHKKEIEMINEMAFAPSEGQ
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtgggcgtggattgaatgacatcctacttattggacagtttttaaaacatcct
ctctcttctgcgtttattcctttccccacacaacttcctgccgccatgctcaggtcaatt
ccaaaacatatccgtataccgtctcgatcaacggctcagcccgctagggccatactctcc
ctctctgctgtccagcgacatactcaaaaacgaagctatgctgcagaggccgtcgctccc
agtaagaatgatgccttcgccaacggcggaaatgcgtactacactgaggagatgtaccgc
ctctggaaacaagaccccaagtctgtccatgtatcctggcaaacttacttctctggcctc
gacaagggtcttccttctgctcacgctttcactcctccccccggtgttctctctggtgcc
gttcctacccctgccggcggaagccccaaactttctgttgagggcagtggtgatgtcact
gattatcttaaagttcaacttttgatccgtgcctaccaagttcgaggtcatcacattgcc
aacctcgatcctcttcgcatttctggtgccgatctcgacggtcgtgtccctcctgagctt
aaactcgactactatggttggactgaagccgacatgacgaaggaattcaggcttggcgac
ggcattctcccccgattcatgggtcaggtcaaggacgacacgatgactctgggtcagatc
attgatgagctcaagcagatgtactgtacccacgttggctgccagtacgttcacatcccc
gaccggggacaatgcgactggatccgggagcgcgtcgaaattcctacccaatggaactac
tccaccgaggaaaagaggatgattcttgaccgactcatgtggtctgagctttttgaaaag
ttcattgcctccaaataccccaacgagaagcgtttcggtcttgagggttgcgagtctttg
atccctggtatgaaggcgctcattgatcgttccgtggatgctggtgtcaaatctatcgtt
cttggtatgccccaccgtggtcgtcttaacgtccttggtaacgtcatccgaaaacctatt
gaggccatcttaaacgagttcaagggtaacgaggatgccgacgatactggcggtggtgat
gtcaaataccacctcggtgccaactacatccgtcctactcccagcggcaagaaggtttcc
ttgtcccttgttgccaacccttcgcacttggaggctgaagacccagttgtcctcggtaag
accagggctatccagcactttgaaggtgacgagggagacggatcctctgccatgggcgtt
ttgctccacggtgacgctgcctttgctggtcaaggtgttgtttacgagaccatgggtatg
caaaaccttcccaactacggcactggtggtaccgtccacttgattgtcaacaaccaaatt
ggtttcaccaccgacccccgatttgcccgttctaccccttacccctctgatattgccaag
tctatcgacgcccccatcttccacgtaaacagtgacgatgtcgaggccgtcaactacgtc
tgtaccctcgctgctgactggcgagctaccttcaagaaggatgtagttatcgatattgtc
tgttaccgacgatacggtcacaacgagactgaccaacccagcttcactcagccaaagatg
tacaaggctattcaaaagcaacctaccgtcttgtctatctacaccgacaagttgatcaag
gaaggtacttttactgaaaaggagattgacgagcacaggcaatgggtttggggcatgctt
gagaaggcttacgacggatccagggactacaagccttctccccgagaatggctttcctcc
tcttgggaaggtttcccttctcccaaggagcttgccgaagaggttctccctcagcaccat
accggtgccagcgaggacgccctcaagcgtgttggtcagatcatctctagtttccccgaa
ggtttccacccccacaagaaccttgcgcgaattattggcaaccgaggcaagactgtagcc
gaaggcaagaacattgactggtctactgctgaagctcttgctttcggtactttgtgcctt
gagggtactcacgttcgaatctccggtcaggatgttgagcgtggtactttttctcagcga
cacgctgtcgtccacgaccaaaagactgaacagactcacatcgctctcaagcacctggat
gctgaccagggctctttcactgtcaccaactctcacttgtcagagtttggtactctcggt
ttcgagctcggttactctcttgtctcccccaacagtttgactatctgggaggctcagttc
ggtgactttgccaacaatgcccaatgtatcattgaccaattcattgctgcgggtgagcga
aaatggctccagcgaactggtctggttctctccttgcctcacggttacgacggtcaaggt
cccgagcactcttctggtcgtatcgagcgattcctccagctctgtgacgatgagccccga
gtgtacccctcgcctgaaaagttggagaggcagcaccaggactgcaacatgcaggtcgtc
tacccgactactcctgccaactatttccacgttctcaggcgacaaaacaagcgtgacttc
cgaaagcccttgattgtcttcttctccaaatcccttctccgacatcctcttgcccgatct
tctctcgaggagatgtctggtgactccaagttccagcgatatattcccgaaccccatcct
gaatcccttgtcgagcctgagaagatccgacgacacattttatgtactggccaggtctac
ttccagctcctcaaggagcgtgaagagcgaggtatcaacgacgttgccatttccaggatt
gagcaattgtctcccttgccttatgaccgtttgactcctcatcttgacaagtaccccaac
gctgatcttgtctgggcccaggaggagcctctcaacaatggtgcctggacctacgttcag
cctcgactcatcaccgccctccaggagactgagcatcacaagtccaagatcccattctac
gctggtaggaaacctagcagttccgttgctaccggttccaagtatgcgcacaagaaggag
attgagatgatcaacgagatggcttttgctccttccgaaggacagtag

DBGET integrated database retrieval system