KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBD4830Help
Entry
CNBD4830          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CNBD4830
Enzymes [BR:cnb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CNBD4830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 4935872
NCBI-ProteinID: XP_775754
UniProt: Q55TH0
LinkDB All DBs
Position
4
AA seq 152 aa AA seqDB search
MVKAVAVLKGDSHVYGTITFTQDSEGAPVCVSGENLDADAKRGFHVHEFGDNTNGCTSAG
PHYNPFHKNHGGPTAAERHVGDLGNVQTNGCGVAMVDISDKVISLFGPHSIIGRSMVVHA
GTDDLGKGGNEESLKTGNAGARLACGVIGIAA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggctgttgctgtcctcaagggtgactcccacgtctacggtactataactttt
acccaggactcggaaggcgctcccgtttgcgtctcgggtgagaacctcgacgctgacgcc
aagcgaggcttccacgtccacgagtttggagacaacaccaacggctgtacttctgccggt
ccccattacaaccccttccacaagaaccacggtggtcccactgccgccgagaggcacgtt
ggtgacctcggtaacgtccaaacgaacggctgcggtgtcgctatggttgacatttccgac
aaggtcatctccctcttcggccctcactccatcattggtcgaagtatggtcgtccacgcc
ggtactgacgatctcggcaagggcggcaacgaggagtccctgaagactggcaatgcaggt
gcccgtcttgcctgcggtgtcatcggtatcgccgcttaa

DBGET integrated database retrieval system