KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBE3490Help
Entry
CNBE3490          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00500  Starch and sucrose metabolism
cnb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CNBE3490
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CNBE3490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF1966
Motif
Other DBs
NCBI-GeneID: 4936359
NCBI-ProteinID: XP_775075
UniProt: F5HEZ5
LinkDB All DBs
Position
5
AA seq 532 aa AA seqDB search
MLTYQAALALIPFISFLPAYALDADAMRSRSVYQVVTDRFARNSSSTGDCNVADRTYCGG
TWSALADKLDYIQGMGFDTVWISPVVENIGGTTGEGEAYHGYWTLDPESLNSNFGSADDL
KTLSSSLHARGMYLQVDVVVNHVAATSSSTFQPSESYGPFSTSEDYHPFCWITDYNNQTN
VEQCWLGDDSVALADLNTESDTVVSYWNQWITDLVSNYTFDAIRIDTVKHVRQSFWPDFV
NAAGVFNQGEVLLADVPYVAGYQKNASINPFNYPVYYPLVRAFNGTGQSFSELINMVSYV
NSNFTDPTLLGTFLDNHDNARFESFVTDPSLIKNAQAYPLVTDGIPYVYYGSEAGFNGGN
DPENREPMWTSNYDTSSDMYKFFTSLNAARSAAGNASSTFYTDKMTLSQPSESTLLVAKK
PLMSVFSNSGSSASNTSVSVDSSSSGWAASTNVIDALTCESFTTDDSGNLAVTIYQGEPR
VLIEDSQKGSLCGGSSSNSSSTSNDSGAGMTTKVSGWVALAGVFVAGLQVLL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcacctatcaagcagccctagcgctcatccccttcatctcattcctcccagcatat
gcccttgatgctgatgcgatgcgctcgcgctcagtctaccaagtcgtcaccgatcgattt
gcgcgtaattcttcttcaaccggcgattgtaatgtcgccgaccgcacatactgcggtggt
acttggtccgctctcgccgacaaactcgactatattcagggaatgggctttgacactgtc
tggatatctccggtcgtcgaaaacattggcggcactacaggcgagggcgaggcatatcac
ggttactggactcttgatcccgagtccctcaactccaactttgggtccgctgatgacctt
aagactttgagttcttcattgcacgccaggggaatgtacctccaggtcgacgtcgtcgtt
aaccacgtcgctgccacgtctagttctaccttccaaccctccgaatcttacggtcctttc
agtacttctgaagactaccaccctttctgctggatcactgactacaacaaccagaccaac
gttgagcaatgttggcttggtgacgactctgtcgctttggccgacttgaacactgagagt
gacactgttgtttcttactggaaccaatggatcacagaccttgtttccaactacactttc
gatgccattcgaattgataccgtcaagcatgttcgtcaatctttctggccagatttcgtc
aacgctgccggtgtcttcaaccagggtgaagtcctcctggcggatgtgccatatgtcgct
ggctaccagaagaatgcgtctatcaaccctttcaactaccccgtttattatccccttgtt
cgcgctttcaacggcactggacagagcttcagcgagctcatcaacatggtttcttatgta
aatagcaacttcaccgaccctacccttcttggtactttcttggacaaccacgataacgcc
aggtttgagagctttgtcaccgacccttcattgatcaagaatgctcaggcttatcctctt
gtcaccgatggaattccctatgtttactacggtagtgaagccggcttcaacggtggcaac
gaccctgagaaccgagagcccatgtggaccagcaactacgacaccagttccgacatgtac
aagttcttcacttctttaaacgctgcccgttctgctgctggcaacgcttctagcactttc
tatactgacaagatgactctctctcagccctctgagagcacccttctcgttgccaagaag
ccccttatgtctgttttctctaacagcggttcttccgcttccaacacctctgtttccgtc
gactcttcctcttccggctgggccgcttctaccaacgtcattgacgccctcacttgcgag
tctttcactaccgacgattccggaaacctcgcagtgaccatctaccagggtgaaccccgg
gttctcatcgaggacagccaaaaaggatccttgtgcggtggctctagctctaattcttct
tcaacctctaacgacagtggcgcgggaatgaccacaaaggtcagcggctgggtcgcactt
gcaggtgtcttcgttgctggattacaggttcttttgtaa

DBGET integrated database retrieval system