KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBF4070Help
Entry
CNBF4070          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00052  Galactose metabolism
cnb00500  Starch and sucrose metabolism
cnb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CNBF4070
   00500 Starch and sucrose metabolism
    CNBF4070
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CNBF4070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 4936959
NCBI-ProteinID: XP_774728
UniProt: Q55QD0
LinkDB All DBs
Position
6
AA seq 563 aa AA seqDB search
MVCVVSDPDWWRQAVVYQIYPRSFADANGDGIGDLKGITARVPYLKALGVDAIWLSPFYP
SALRDGGYDVADYRDVDPKIGTLEEFDEMTAAFQKVGIRVIVDIVPNHSSDDHEWFQAAL
KAGKGSPERERYIFRDGLGPNKDQPPTDWICSFGGSAWSPSGMNDGQWYFHWFDSSQPDW
NWENPDVKADFLKTLKFWGDRGVSGFRIDVAHGLAKDMSEPLPNWEQLTKLTHQKLTNGN
SELDHPLLDRKEVHDIYRSWREVFNQFNPPLMAVAEAWVAPDQKPLYASSEGLGQTFSFD
ILLCNFDAEEYRQCIKSSLAGSKKSDSTTTWVLSNHDVMRHPTRFGLPNVPNANHAMTTD
TYNKFLKTKLTDPKVDIEQGLRRAKAATLMILALPGSTYLYQGEELGLQEVVEIPDEERQ
DPIFIRTKGEEVGRDGCRVPIPWVADEKNFGYGPGKRAHLPQPAWFKDYAVDVEEKDANS
VLSLYRRALGLRKELQSAEELEWVENPNKEVLHFRRPGGWEVVVNIGKDSVDLPKGSVLI
SSSNNALKGGSIPGETTVWLKSA
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggtctgtgttgtttccgaccccgactggtggcgccaggccgtcgtctatcaaatctat
ccccgttccttcgccgacgcaaacggtgatgggattggagacttaaaaggtataactgct
cgtgtgccgtatttgaaagcattaggagtggatgccatctggctcagccctttctatcct
tccgctttgcgggatggcggttatgatgtggccgactacagggatgtcgacccgaagatc
gggacattggaagagtttgacgaaatgaccgctgctttccaaaaagtcggaatccgagtc
atagtcgatatcgtccccaaccattcaagcgatgaccatgaatggttccaagctgctttg
aaagcgggtaaggggtccccagagagggaaaggtacatttttagagatggtctcggaccc
aacaaagatcagcctcctaccgactggatctgttctttcggtggatctgcttggtcgcct
tctggaatgaacgacggtcaatggtatttccactggtttgactcctctcaaccggactgg
aattgggagaacccagatgtcaaagcagatttcctgaagaccttgaagttttggggtgat
cggggagtctcaggtttccggattgacgtcgcccacggccttgctaaagacatgagcgag
cccttgcctaactgggagcagttgactaaattgactcatcaaaagctcactaacggtaac
tccgagttggatcatccccttctcgacaggaaggaggtacacgatatctacagatcttgg
agggaagtcttcaaccagtttaatcccccactcatggctgttgctgaagcctgggttgct
ccagaccaaaaacccctctacgcttcttctgagggtctcggccagaccttctctttcgat
attcttttgtgcaactttgatgctgaggagtaccgtcaatgcattaagagttcattggca
ggaagcaaaaagtccgactcaactactacctgggtactgtccaatcatgatgtaatgcga
catcccacccgattcggtctccccaacgtcccgaatgcgaaccatgcaatgactacggac
acctataacaagttccttaaaaccaagttgacggatcccaaggttgatattgagcaaggg
ttgaggagagccaaagcggctactcttatgattcttgccttgccgggatctacataccta
tatcagggcgaagaacttggcttgcaagaagtcgtcgaaattccagacgaggaacgacaa
gaccctatattcatccgaacaaagggagaagaagtcggccgtgatggctgtcgagttcct
attccttgggttgccgacgaaaagaactttggttacggtcctggaaaacgtgcgcatctc
cctcagcctgcgtggttcaaagactatgcggtcgatgtagaggaaaaggatgccaacagc
gtattaagcctttaccgacgggctttaggattgagaaaagagctgcaatctgcagaggag
cttgaatgggtggagaatcctaacaaagaagtcctgcatttccgaaggcccggtggatgg
gaggtagttgtcaacatcggcaaagattctgttgatctgcccaagggttccgttcttatt
agttcatctaataacgcgctcaagggtggaagcattcctggggagacgactgtttggctc
aagtctgcgtaa

DBGET integrated database retrieval system