KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBG1290Help
Entry
CNBG1290          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00020  Citrate cycle (TCA cycle)
cnb00190  Oxidative phosphorylation
cnb01100  Metabolic pathways
cnb01110  Biosynthesis of secondary metabolites
cnb01130  Biosynthesis of antibiotics
cnb01200  Carbon metabolism
Module
cnb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cnb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cnb_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CNBG1290
  Energy metabolism
   00190 Oxidative phosphorylation
    CNBG1290
Enzymes [BR:cnb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CNBG1290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2
Motif
Other DBs
NCBI-GeneID: 4937163
NCBI-ProteinID: XP_774483
UniProt: F5HG87
LinkDB All DBs
Position
7
AA seq 280 aa AA seqDB search
MVRPATVLRSLNAIPSTSRPLAAAARSFHATASAQLATPVEGKQPPIKEFKIYRWNPDVP
NEKPKLQTYKIDLSQCGPMMLDALIKIKNELDPTLTFRRSCREGICGSCAMNIDGVNTLA
CLCRIPKDTSKDSKIYPLPHMYVVKDLVPDLTHFYKQYKAIEPYLKNDNPPEKGEFLQSQ
ADRKKLDGMYECILCACCSASCPSYWWNQDEYLGPAVLMQAYRWMADSRDSYGAERKEKM
QNAMSLYRCHTIFNCSRTCPKGLNPAAAIAKMKLEMATGE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggtccgcccagccaccgtcctccgttctctgaacgctatcccttccacctccagaccg
ctcgccgctgccgccaggtctttccacgctaccgcttctgctcagctcgccactcctgtt
gagggaaagcagcctccaattaaggagttcaagatctaccgatggaaccccgatgtcccc
aatgagaagcccaagctccaaacatacaagatcgatctctcccaatgcggccctatgatg
ctcgatgctttgatcaagatcaagaatgagctcgaccccactcttactttccgacgatct
tgccgagagggtatctgtggttcctgtgccatgaacattgacggtgtcaacactcttgct
tgcttgtgccgaattccaaaagacacctccaaggattccaagatttacccccttcctcac
atgtacgtggtcaaggacctcgtccccgaccttacacacttctacaagcaatataaggct
atcgaaccttacctcaagaacgacaaccccccagaaaagggagagttccttcaaagtcag
gcggacaggaagaagctggacggaatgtacgagtgtattttgtgtgcttgttgctcagcc
tcttgcccttcatactggtggaatcaagacgaatatcttggtcccgcagtgttaatgcag
gcttaccgatggatggctgactctcgagattcttacggcgccgagcgaaaggagaagatg
cagaacgccatgtctctttaccgatgccacaccatcttcaactgctctcgaacatgtccc
aagggtcttaaccctgccgccgcgattgccaagatgaagctcgagatggctaccggagag
taa

DBGET integrated database retrieval system