KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBH3130Help
Entry
CNBH3130          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00020  Citrate cycle (TCA cycle)
cnb00190  Oxidative phosphorylation
cnb01100  Metabolic pathways
cnb01110  Biosynthesis of secondary metabolites
cnb01130  Biosynthesis of antibiotics
cnb01200  Carbon metabolism
Module
cnb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cnb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cnb_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CNBH3130
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CNBH3130
Enzymes [BR:cnb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CNBH3130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA Lycopene_cycl FAD_binding_3 HI0933_like SecA_SW
Motif
Other DBs
NCBI-GeneID: 4937837
NCBI-ProteinID: XP_773861
UniProt: F5H9C1
LinkDB All DBs
Position
8
AA seq 637 aa AA seqDB search
MLALSRTRALARPLRNNFARNYVVASQTARATEAPNFGQKKGYPIIDHEFDAVVVGAGGA
GLRAAFGLAEGGLKTACITKLFPTRSHTVAAQGGVNAALGNMTEDDWRWHMYDTVKGSDW
LGDQDAIHYMCREAPHTVIELEHYGVPFSRTKEGKIYQRAFGGQSLKYGKGGQAYRCAAA
ADRTGHAILHTLYGQSLRHNTNFFIEYFALDLLMQDGECVGVLAINMEDGTLHRFRSHKT
VLATGGYGRAYFSCTSAHTCSGDGNAMAVRAGLPLQDLEFVQFHPTGIYGAGCLITEGSR
GEGGYLVNSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPEKDHIFLQLSHLP
AEVLHERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTKYTGEVLTIDEQGNDKV
VPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACANHIKETLAPNTPHKPMNPELGKE
SIEDLDKIRNASGPLPTSQIRLNMQKTMQTDAAVFRTQQSLDEGVAKMREVYKSYDQVGI
KDRSMIWNSDLIETLELRNIMQNAMQTVVSAAARKESRGAHAREDYPERNDEEWMKHTLS
FQHDPNSPDVELKYRGVIANTLDEAECKPVPPFKRTY
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccctctctcgtacaagggccctcgcccgccccctccgcaacaacttcgcaagg
aactatgtcgtcgcttcccagacagcccgcgctacagaagctcccaacttcggccagaaa
aagggatacccaatcatcgaccacgagtttgacgctgtagttgtcggtgctggtggtgcc
ggtttgcgagctgctttcggtcttgccgagggtggactcaagaccgcctgtatcaccaag
cttttccccactcgatcccacactgtcgccgctcagggtggtgtcaacgctgctctcggt
aacatgacggaggacgactggagatggcacatgtacgacactgtcaagggttctgattgg
ttaggtgaccaggatgctatccactacatgtgtagggaggcccctcacactgttatcgaa
cttgaacactacggtgtgcccttctcccggaccaaggagggcaagatctaccagcgagct
ttcggtggtcagtctctcaagtacggtaagggtggtcaggcctaccgatgtgctgccgcc
gccgaccgaactggtcacgccattctccacaccttgtacggtcaatctctccgacataat
accaacttcttcatcgagtactttgctctcgaccttctcatgcaggatggcgagtgtgtt
ggtgtgcttgctattaacatggaggacggtaccctacacagattccgaagccacaagact
gtcttggctacaggtggttacggccgagcgtatttctcctgtacttctgcccacacctgt
tccggtgacggtaacgcgatggccgtgagggctggtttgcctttgcaagatttggagttt
gttcagttccaccctactggtatttacggcgcaggttgtcttatcactgagggttctcga
ggtgagggtggttacctcgtcaactctgagggtgagcgattcatggagcgatacgccccc
accgccaaggaccttgcttctcgagatgtcgtctcccgatccatgaccctcgaaatccga
gaaggtcgaggtgtcggccccgagaaggaccacatcttcctccaactcagtcacttgcct
gccgaagtcttgcacgaacgattgcctggtatctctgagaccgctgctatctttgccggt
gtcgatgttaccaaggagcctatcccagttttgcctactgtccattataacatgggcggt
attcccactaaatacaccggcgaagtcctcaccatcgatgagcaaggcaacgacaaggtc
gttcccggtctttatgccgccggcgaagccgcctgtgtctctgtccacggtgctaaccga
ctcggtgccaactccttgctcgacattgtcgtctttggccgtgcttgcgcaaaccacatt
aaagaaactcttgcccccaacactcctcataagcctatgaaccccgagcttggcaaggag
tctattgaggatcttgacaagattaggaatgctagcggtcctttgcctacttcccagatc
aggttgaacatgcagaagacaatgcagaccgacgccgccgtcttccgaactcaacaatct
ttggacgagggtgttgctaagatgagggaagtctacaagtcttacgaccaggtcggtatc
aaggacaggagtatgatctggaactccgacctcattgagaccctcgagcttaggaacatt
atgcagaacgccatgcagactgtcgtttcagctgctgctaggaaggagtctcgaggtgcc
cacgcccgagaggactaccccgagcgtaacgacgaggagtggatgaagcacaccctttcc
ttccagcatgatcccaactcccccgacgtcgagctcaaataccgaggcgttattgccaac
actcttgacgaggctgagtgcaagcccgttcctcctttcaagcgaacttattaa

DBGET integrated database retrieval system