KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBL1260Help
Entry
CNBL1260          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00052  Galactose metabolism
cnb00500  Starch and sucrose metabolism
cnb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CNBL1260
   00500 Starch and sucrose metabolism
    CNBL1260
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CNBL1260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 4939175
NCBI-ProteinID: XP_772511
UniProt: F5HEX1
LinkDB All DBs
Position
12
AA seq 971 aa AA seqDB search
MTLLFQFLTLLLPILAGAIPAYRPATLESFQLRDQSSWAVASQQPDFSGDVTQCKGYAIN
SDSVRQTSTGGISAQLDLITYCSAYGTDIPSLTLSVEYETSSRLHVHIYDTPVKQFQIDD
NILPRPKRTLFGTDSADKSDLKFDYENSPFAFWVTRKSDGEILFDTRKDGIPIHEDPSDI
LGSPSNYTVMPAHPLVFEDQYLQLSSKLPVGANIYGLGEAVSGSGYRRNSSSTVQTMWAR
DIADPVDENLYGTHPFYMEVRYNETSCTLASHGVFLRNSNGMDVVLRDGAIQYRVIGGTL
DLYFVSGPSPNDVTEQYVSTVGLPQSMPEWSFGFHLCRWGYTSANDTLSVVNRMRDAGIP
LETQWNDIDWMRSYREFQFDQNYGEVDYRNLVETLHSRNQHYIPIFDAAIGHPLNATDRF
DVYDKGHELGVWMRNPDGTEYVGAVWPTFAVFPDWFHPKMQEVWTEAFYNYSQIVDFDGI
WLDMNEPSSFVDGSASNSTMSLENTTVIPPDYSTVAFPTDWPEGYSNVTGISGNVTVDGA
LTYGADGDAAKNTALRRSLIGRDDVLTIPYVDVPPYPINNGYGRLSAKTVSPNATHYGGL
QEYSVHNLWGSMEEDATNNMFLALKPGKRPFMVSRSTFAGSGRKTAHWLGDNFSTFAYMK
RSIQGVLQFNLFGIPMVGPDVCGFNGNTDEELCNRWMQLGAFFPFFRNHNIKSAISQEPY
VWDSVRDASIKAINARYQMLPYWSTLFAKSSLAGTPAVIPLFHEFPSPSYLDNDYQFLIG
PSVLVTPVLQPNESTVVGQFPTMNDVFWVDWWTHCKLDTSSGEDVTLDLPLGNIGVHVRS
GSALLLYDEPGYTVKETKDNGYAILVVLDGKGYAEGDAKIDDGESLPVTEQTCLTFKSTD
SCKLSSTAVGSYTIAGKLKTITIVGVWTEPSEVTLNGSKVQDSQVEYDKSLGRIKITGLV
QDLNSAWELMW
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atgactcttttattccagtttctcaccttgcttctccccatactggcaggagccattcct
gcatacaggcctgccaccctcgagtctttccaactacgagatcaaagcagctgggccgtt
gccagtcagcaacctgacttctctggtgatgtcacacagtgcaagggctacgccattaat
tctgattcagtcaggcaaacatccacaggtggaatctctgctcagctcgacttaattacc
tactgttccgcgtatggcacagacattccatctcttaccctttccgttgagtacgagact
tcatcgcgactacatgtccacatctatgacactcctgtcaagcaattccagattgatgac
aacatcttacctcgcccgaaacgaaccctctttgggacagatagtgccgacaaatcggat
ctcaagttcgactacgagaacagtccttttgctttctgggtcactcggaagtcagatggc
gagatcttattcgataccagaaaggatggtatccccattcatgaagacccttcagacatc
ttggggtctcctagcaactacacagttatgcctgctcatccgctcgtctttgaggatcaa
tatctgcagttgagctccaaattgcctgtcggagcgaacatctacggcttgggcgaagct
gtttccggaagtggctaccgcaggaactcgagctccaccgtgcagactatgtgggcaaga
gatatcgctgaccctgtcgatgaaaacctttacggtactcatcccttctacatggaggta
aggtataatgagacttcctgcactcttgcttcacatggcgtattcttgcgaaactcgaat
ggtatggacgttgtcctccgagatggtgctattcaataccgagtcattggtggcacactc
gacctctacttcgtttccggtccaagccccaacgatgtaaccgaacaatacgtatccacc
gtcggccttccgcaatccatgcctgaatggtcctttggattccatctttgtcgatggggt
tatacttccgccaacgacactctctcagttgtcaataggatgagagacgctgggattcct
ttggagacacaatggaatgacatcgactggatgaggagctacagagaattccaatttgac
cagaactatggagaggtcgattaccgaaacctagtggagactcttcactctcgcaaccag
cactacattcccatattcgacgcggctatcggtcatccgctcaatgctacggataggttc
gatgtatatgacaagggtcacgaacttggagtttggatgagaaaccctgatggtactgag
tacgtcggtgccgtctggccaactttcgccgtcttcccagactggttccaccccaagatg
caggaggtttggacagaggccttctacaattactcccagattgtcgattttgacggtatc
tggcttgatatgaatgaaccgtcatctttcgtcgacggttctgccagcaactctacaatg
tctttggagaataccacagtcattcctcccgattattctaccgtcgcattccctactgac
tggcctgagggttattcaaatgtgactggcatcagcggtaacgtcactgtagatggcgcc
ctcacttacggtgcagatggcgacgccgctaagaacaccgctcttcgtcgttccctcatc
ggtcgagacgatgttctcaccattccttacgttgacgtccctccctaccctattaacaac
ggttacgggagattatccgccaagacagtcagccctaacgctacccattatggaggtctt
caagaatacagtgttcataatctttggggttccatggaagaggatgctacgaacaacatg
ttcttagccttaaagcctgggaagaggccattcatggtttctcgatctacgtttgccggc
agtggtcgaaagaccgcccattggctcggtgacaacttctccacttttgcctatatgaag
aggtctatccaaggcgtcttacagttcaacttgttcggtatccccatggttggccctgac
gtctgtggctttaatggcaacacggacgaagagctttgtaaccgatggatgcaacttggt
gctttcttcccatttttcaggaaccacaacatcaaatctgcaattagccaagagccttat
gtttgggactctgtccgtgatgccagtatcaaggccatcaacgctaggtatcagatgttg
ccttactggtcgacattattcgccaagtcctctcttgccggaactcctgccgttattccc
ctcttccatgagttcccctcccccagttaccttgacaacgactaccagttcctcattggt
ccctctgtacttgtcactccagtacttcaacctaacgagtcaactgtagttggccaattc
cccaccatgaatgatgttttctgggttgattggtggactcactgtaaacttgacacttct
tccggcgaagatgttactctcgatttgcctctcggaaacataggtgtgcacgtcaggagt
ggtagtgctttgttgctctacgacgagcctggttatactgtcaaggagacaaaagataat
ggttacgctatactggtcgtgcttgacggcaaaggttacgcggaaggcgatgccaaaatt
gatgatggtgaaagtttgcctgtcaccgaacagacttgcctcacatttaaatccactgat
tcctgcaaactctcttccacagctgtcggcagctacaccattgctggcaagctcaagact
attaccattgttggtgtttggactgaaccttccgaagtcaccctcaacggtagcaaggtc
caagatagccaggttgagtatgacaagagcttaggcagaatcaaaattaccggtcttgtt
caggacctcaattctgcctgggagcttatgtggtaa

DBGET integrated database retrieval system