KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBM2220Help
Entry
CNBM2220          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CNBM2220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cnb02000]
    CNBM2220
Enzymes [BR:cnb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CNBM2220
Transporters [BR:cnb02000]
 Other Transporters
  Pores ion channels [TC:1]
   CNBM2220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C Glutaredoxin GST_C_3
Motif
Other DBs
NCBI-GeneID: 4939584
NCBI-ProteinID: XP_772065
UniProt: F5HGN9
LinkDB All DBs
Position
13
AA seq 262 aa AA seqDB search
MPMPDEHIHPTATGLAKKVVDAHQDPQDLVFWSGWFCPFNQRIWIALEERKIPYQYHEVN
PYKKEEAFLKLNPLGLVPTVEIKTAEGSKSLYESDVLVEFLEDLYPPSEEHPSIFPSDPY
EKSWVRLNIQHVSKKIIPNYFKLQQSQTESDQVAARKELISALRTYAKRIKGPYFAGEQW
TAVDGTLAPFIRRLYILEKHRNFDEKAVGDGWWEYRERLMTRDSLKNTCSEDQYYEEILG
RYLKNEAQSEVAKATRAGQSLP
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcctatgcccgacgaacatatccatcccactgccacaggccttgccaagaaggtcgtg
gacgctcatcaagatccccaagatttggtattctggagcggatggttctgcccctttaat
cagcgtatctggatcgcccttgaggaacgaaaaataccttaccaataccatgaagtaaac
ccatacaagaaggaagaggcattcctcaagcttaatcctctagggcttgtgccgacagtc
gagatcaagactgccgaaggtagcaaatcgctttacgagagtgatgtcctggtcgagttc
ttggaggatctttatcctcctagcgaggagcatccgtccattttcccttctgatccatac
gaaaagtcttgggttagactcaacatccaacatgtctccaaaaaaatcatccccaattac
tttaaactccaacagtcccaaaccgaatcagaccaagttgctgcccgcaaagaactcatc
tccgctcttcgcacatacgccaaacgcatcaagggtccttattttgcaggcgaacaatgg
acagccgtcgacgggacattggcgccgtttataaggaggttgtatattcttgaaaaacat
aggaattttgatgagaaggcggttggggacgggtggtgggagtatagagagagattgatg
actcgcgattcgcttaagaatacttgttcagaggatcagtattacgaggaaatcttggga
agatacctcaaaaatgaagctcaatcagaagtcgctaaagctactcgtgctggccagagt
cttccctaa

DBGET integrated database retrieval system