KEGG   Cupriavidus necator N-1: CNE_1c09450Help
Entry
CNE_1c09450       CDS       T01564                                 

Gene name
maeB1
Definition
(GenBank) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00620  Pyruvate metabolism
cnc00710  Carbon fixation in photosynthetic organisms
cnc01100  Metabolic pathways
cnc01120  Microbial metabolism in diverse environments
cnc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CNE_1c09450 (maeB1)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CNE_1c09450 (maeB1)
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     CNE_1c09450 (maeB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M ELFV_dehydrog Malate_DH
Motif
Other DBs
NCBI-ProteinID: AEI76302
UniProt: G0EZJ7
LinkDB All DBs
Position
1:966209..968530
Genome map
AA seq 773 aa AA seqDB search
MSSKISGDAPQHAPNSPEAQLRLAALEYHRSPTKGKIQVTATKALSNQRDLSLAYSPGVA
YACEEIAKDPATAAEYTSRANLVAVITNGTAVLGLGDIGPLAGKPVMEGKGCLFKKFAGI
DVFDIELDARDPDKIVEIVAALEPTLGGVNLEDIKAPECFYIEQKLRERMNIPVFHDDQH
GTAIISTAALLNGLKVVGKDVGKVKLAVSGAGAAAIACLDTMVSLGVKRENISVVDSKGV
IYVGRDVNMEANKARYAQDTSARTLADIVKDADVFLGCSTAGVLTAEMVKTMADKPIILA
LANPEPEIRPEVAKAARPDCIIATGRSDYPNQVNNVLCFPYIFRGALDCGATKITEAMKL
ACVKAIAELAEAELNDAVAAAYGGRELKFGPDYIIPTPFDQRLIEKIAPAVAKAAEESGV
ATRPIKDLEAYRQQLSTYVYHTGLIMKPVFSAAKAAPKRVAYAEGEEERVLRAVQTVVDE
GLARPTLIGRPHVIQMRIEKAGLRLKAGVDFDLVNPEEDPRYRAYHEAYHALRGRDGVTP
DMAKVALRRSNTLIGTMLMHMGDADALLCGTVGRFEAHLEHVRDVIGLAPGAKVFAAMNA
LMLEKHTLFITDTFVNDDPSAEELAAIAQLAAEEIARFGLVPKAALMSHSMFGSSTRPSA
RKMREAAAILAKVAPHLEVEGEMQGDAALDEDVRRHFLPSTKLAGSANLLVMPTLDAANI
AFNLLKITGGQGVTVGPILLGAARPVHILNPQATTRRIVNMTAVAVAESGAVR
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaagattagcggtgatgcaccgcaacatgccccgaacagtcctgaagcgcag
ctgcgcctcgctgcgctggaataccaccgcagccccaccaagggaaagatccaggtaacc
gcgaccaaggcgctgtccaaccagcgcgacctgtcgctggcctactcgccgggcgtggcc
tatgcctgcgaggaaatcgccaaggaccccgctaccgccgccgagtacacctcgcgcgcc
aacctggtggccgtgatcaccaacggcaccgccgtgctgggcctgggcgatatcggcccg
ctggccggcaagccggtgatggagggcaagggctgcctgttcaagaagttcgccggcatc
gacgtgttcgacatcgagctcgacgcgcgcgacccggacaagatcgtcgagatcgttgcc
gcgctcgagcccacgctgggcggcgtgaacctggaagacatcaaggcgccggaatgcttc
tacatcgagcagaagctgcgcgagcgcatgaacatccccgtcttccacgacgaccagcac
ggcaccgccatcatttcgaccgcggcgctgctcaatggcctgaaggtggtcggcaaggac
gtcggcaaggtgaaactggccgtgtccggcgccggcgcggctgccattgcctgtctggac
accatggtcagcctgggcgtgaagcgcgagaacatctcggtggtggactccaagggcgtg
atctacgttggccgcgacgtcaacatggaagccaacaaggcgcgctacgcacaggacacc
tcggcgcgcacgctggctgacatcgtcaaggacgccgacgtcttcctgggttgctcgacc
gccggcgtgctgaccgccgagatggtcaagaccatggccgacaagcccatcatcctggcg
ctggccaaccccgagccggaaatccgcccggaagtggccaaggccgcgcgcccggactgc
atcatcgccaccggccgttcggactacccgaaccaggtcaacaacgtgctgtgcttcccg
tacatcttccgcggcgcactggattgcggcgcgaccaagatcacggaagcgatgaaactg
gcctgcgtcaaggccatcgccgagctggccgaggccgagctgaacgacgccgttgccgcc
gcctacggcggccgtgagctgaagttcggcccggactacatcatcccgaccccgttcgac
cagcgcctgatcgagaagatcgcgccggcggtggccaaggccgcggaggaatccggtgtg
gccacgcgcccgatcaaggacctcgaagcgtatcgccagcagctgtccacctatgtctat
cacaccggcctgatcatgaagccggtgttctcggccgccaaggccgcgcccaagcgcgtg
gcctacgccgagggcgaggaagagcgcgtgctgcgtgccgtgcagaccgtggtggacgaa
gggctggcgcgccccaccctgatcggccgcccgcacgtgatccagatgcgcatcgagaag
gccggcctgcgcctcaaggccggggtggacttcgacctggtcaatccggaagaagacccg
cgctaccgcgcctaccacgaggcctaccacgcgctgcgcggtcgcgacggcgtgacgccg
gacatggccaaggtggcgctgcgccgctccaacacgctgatcggcacgatgctgatgcac
atgggcgatgccgatgcgctgctgtgcggcacggtcggccgcttcgaggctcacctcgag
cacgtgcgtgacgtgatcggcctggcgcctggcgccaaggtgttcgccgcgatgaacgcg
ctgatgttggagaagcacacgctgtttatcactgacaccttcgtcaatgacgatccctcc
gccgaggaactggccgcgatcgcacaactggccgctgaggaaatcgcgcgtttcggcctg
gtccccaaggccgcgttgatgtcgcattcgatgttcggttcctcgacccgtccgtcggcg
cgcaagatgcgcgaggctgcggctatcctggccaaggtggcaccgcacctggaagtggaa
ggcgagatgcagggcgacgcagcactggacgaagacgtgcgccgccacttcctgccgtcg
accaagctggccggcagcgccaacctgctggtgatgccgacgctggacgcggccaatatc
gccttcaacctgctcaagatcacgggcgggcagggcgtgacggtgggcccgatcctgctg
ggcgcggccaggccggtgcacatcctgaacccgcaggcgaccacacgccgtatcgtcaac
atgacggcggtggccgtggcggagagcggcgcggtgcgctga

DBGET integrated database retrieval system