KEGG   Cupriavidus necator N-1: CNE_1c16030Help
Entry
CNE_1c16030       CDS       T01564                                 

Gene name
ftsK2
Definition
(GenBank) DNA translocase FtsK
  KO
K03466  DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family
Organism
cnc  Cupriavidus necator N-1
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cnc03036]
    CNE_1c16030 (ftsK2)
Chromosome and associated proteins [BR:cnc03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    CNE_1c16030 (ftsK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsK_SpoIIIE FtsK_alpha FtsK_gamma FtsK_4TM AAA_10 DUF87 TrwB_AAD_bind T2SSE AAA_22 DEAD DUF815 AAA_29 Adeno_IVa2
Motif
Other DBs
NCBI-ProteinID: AEI76946
UniProt: G0EUW0
LinkDB All DBs
Position
1:1626779..1630111
Genome map
AA seq 1110 aa AA seqDB search
MGFGWFGFSTFWIVPLVWRLVTRWLAGERRLAGPGSLRVWLGTLAVLCASACLEALTSGT
DPDSSAGGSAGRALAGMMGNLFGWTGALLLMLGVLALAAPMVFGETWRSLFARKPRRGAA
PDAAPEEPPVSFAPTQPLREAERWEPPSAGNPGWTAPATRHRSFEAVSARRQPAWQPPRR
TRESPPQPGEIWLHHAESPNAVKPTRSAPPAPAAPAPAPAPRPAQPAARKPAATAAPSPA
PAPRPAQPLRGTVVSSPFRQPQPLVRSAITTLPEASGKGIAAAAASVTVAAAVSAPAEAA
AAAPAATGATQAVAAPAQPVTSPEPEVVAVPEAPAMEPVSADTDIVGDIAPEAVPAEADE
ATLAAIRQEALDLLAELQALAGKSVVPQAAAPEPQQLEAAAPDSAPNIADDAEPQALSTV
TLPAEAEAEAEAEAEAEAEAEAEAEAEAEAEAEAEAGSGDHVVVIGEPEALATAEPELDV
TGAEAVAQAVASSAMEEGSALDASTQAPAEDNETDGLMDGNGLIAEEAEADAAEPAEAAE
PPEATEAPEAPEVPEVPEVPEPAEAPELNQAPVSAAKPRIVLPAVVGRTPPLPNAQPAPV
PVPVPVPVAPPPSRPFVDYRLPPAELLETGVDSAEQVSEERLRETGELIAQRLAEFKVPV
AVVGAGAGPVITRFEVEPAMGVRGAQVVGLMKDLARALGVTSIRVVETIPGKTCMGLELP
NARRQMIRLSEIVNAASFQAHHSRLVLAMGKDITGNPVVTDLARAPHLLVAGTTGSGKSV
AVNAMILSMLYKATPEDVRLIMIDPKMLELSVYEGIPHLLAPVVTDMKQAAHALNWCVGE
MEKRYKLMSALGVRNLAGYNQKIRAAEAAERKVPNPFSLTPEAPEPLSRLPMIVVVIDEL
ADLMMVAGKKIEELIARLAQKARAAGIHLILATQRPSVDVITGLIKANIPTRVAFQVSSK
IDSRTILDQMGAESLLGQGDMLFLPPGTGYPQRVHGAFVADDEVHRVVEHWKQFGEPDYD
ETILAGDPAEAGSTDLFGDSGGDGEADPLYDEAASFVLTSRRASISAVQRQLRIGYNRAA
RLIEQMEVAGLVSPMGRNGARDVLAPGPGN
NT seq 3333 nt NT seq  +upstreamnt  +downstreamnt
atgggttttggctggttcggattttcgactttctggatagtgccgctggtctggcggctg
gtgacgcgctggctcgccggcgagcgccggctggcagggcccggctcattgcgcgtctgg
ctcggcacgctcgccgtgctgtgcgcgagcgcctgcctggaagcgctgaccagtggcacc
gatccggactcgagcgccggcggttcggccggccgcgcgctggccggcatgatgggcaac
ctgttcggctggaccggtgccttgctgttgatgctgggcgtgctggcgctggccgcgccg
atggtgttcggcgaaacctggcgcagcctgttcgcgcgcaagccgcgccgcggcgccgcg
cccgacgcggcgccggaagagccgccggtttcctttgcgcccacccagccgctgcgcgag
gcagagcgctgggagccgccgtcggcaggcaaccccggctggactgcgcccgccacgcgc
catcgcagctttgaggcggtctcggcgcgccgccagcccgcctggcaaccgccgcgtcgc
acgcgtgaatccccgccgcagccgggcgagatctggctgcaccatgccgagtcgccgaac
gcggtcaagccgacgcgcagcgcgccgcccgcacctgccgcaccggcaccggcaccggca
ccgcgccctgcccagccggcggcacgcaagccggccgcgacggcagccccttcaccggct
ccagcgccgcggccggcgcagcctctgcgcggcacggtggtaagcagcccgttccgccaa
ccgcagcccctggtgcgttcggcgattacgacgctgcctgaggcttccggcaagggcatc
gccgcggccgctgcttcagtcaccgtagctgccgccgtatccgcgccggccgaagccgcc
gccgctgcgccggcggccactggcgccacgcaagccgtggccgctcccgcgcagccggtt
accagcccggaacctgaggtagtggcagtgcccgaagcgcctgccatggaaccagtgtcc
gcagacaccgatatcgttggcgatattgcgccggaagcagtgccggccgaagccgacgaa
gccacgcttgccgcgatccggcaggaagcccttgacctgctggccgagttgcaggcgctg
gctggcaagtcagtggtaccgcaagcggctgcgccggaaccgcaacaactggaagcggct
gcgccggattcagcgccgaatattgccgacgacgcagaaccgcaagcactgtctaccgtc
accctgccagccgaagccgaagccgaagccgaagccgaagccgaagccgaagccgaagcc
gaagccgaagccgaagccgaagccgaagccgaagccgaagccgaagctgggagcggagat
cacgtcgttgttattggggaacccgaagcgctggccacagccgagcccgaattggatgtc
accggcgccgaggccgtagcccaggccgtggcaagctccgcgatggaagagggcagcgct
ctcgatgccagcacccaggcacccgcggaggacaacgaaacggacggattgatggacggc
aacggcctgatcgccgaggaggcggaagcggatgcggccgagcctgctgaggcagcagaa
ccgcctgaagcgactgaagccccggaagccccggaagtcccggaagtcccggaagtccct
gagcccgctgaggcgcctgaactgaaccaggctccggtctcggccgccaagccgcgcatc
gtgctgcccgccgtggtcggccgcactccgccgctgcccaacgcccagccggcgcccgtg
ccggtgccggtgccggtgccggttgcgccgccgccttcgcgccccttcgtcgactaccgc
ctgccaccggccgaactgctggagaccggggtcgacagcgcagaacaggtgtcggaagaa
cgcctgcgcgaaaccggcgagctgatcgcccagcggctggccgagttcaaggtgccagtc
gccgtggtcggcgccggtgccggcccggtgatcacccgcttcgaggtcgagcctgccatg
ggcgtgcgcggcgcccaggtggtcgggctgatgaaggacctggcgcgcgcgctgggcgtg
acctcgatccgcgtggtcgagaccattcccggcaagacctgcatggggctggagctgccc
aatgcgcgccggcagatgatccggttgtcggagatcgtcaacgcggcctcgttccaggcg
caccattcgcggctggtgctggccatgggcaaggacatcaccggcaatccggtggtgacc
gacctggcccgcgcgccgcacctgctggtggccggcaccaccggctcgggcaagtcggtg
gcggttaacgccatgattctgtcgatgctgtacaaggccacgcccgaagacgtgcgcctg
atcatgatcgaccccaagatgctggaattgtcggtctatgagggcatcccgcacctgctg
gcgccggtggtcaccgacatgaagcaggccgcgcacgcgctcaactggtgcgtcggcgag
atggaaaagcgctacaagctgatgtccgcgctgggcgtacgcaacctggccggctacaac
cagaagatccgcgccgcggaggccgccgagcgcaaagtgccgaacccgttctcgctgacg
ccggaggcgcccgagccactgtcgcgcctgccgatgatcgtggtggtgatcgacgaactg
gccgacctgatgatggtcgccggcaagaagatcgaggaactaatcgcgcgcctggcgcag
aaggcgcgcgccgccggcatccacctgatcctggccacgcagcgcccctcggtggacgtg
attaccggcctgatcaaggccaatatcccgacgcgcgtggcgttccaggtctcgtccaag
atcgattcgcgcaccatccttgaccagatgggcgccgagagcctgctcggccagggcgac
atgctgttcctgccgcctggcaccggctatccgcagcgcgtgcatggcgcctttgttgcc
gacgacgaagtgcaccgcgtggtggaacactggaagcagttcggcgagccggactacgat
gaaaccatccttgccggcgaccctgccgaggccggcagcaccgacctgttcggcgacagc
ggcggcgacggcgaggccgacccgctctacgacgaagccgccagctttgtgctgaccagc
cgccgcgcctcgatctccgccgtgcagcgccagctgcgcatcggctacaaccgcgcggca
cgcctgatcgagcagatggaggtggccgggctggtgtcgccgatgggccgcaatggcgca
cgcgatgtactggcgcccgggccgggcaactga

DBGET integrated database retrieval system