KEGG   Cupriavidus necator N-1: CNE_1c23240Help
Entry
CNE_1c23240       CDS       T01564                                 

Gene name
fabI2
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00061  Fatty acid biosynthesis
cnc00780  Biotin metabolism
cnc01100  Metabolic pathways
cnc01130  Biosynthesis of antibiotics
cnc01212  Fatty acid metabolism
Module
cnc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CNE_1c23240 (fabI2)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CNE_1c23240 (fabI2)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CNE_1c23240 (fabI2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cnc01004]
    CNE_1c23240 (fabI2)
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CNE_1c23240 (fabI2)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CNE_1c23240 (fabI2)
Lipid biosynthesis proteins [BR:cnc01004]
 Fatty acid synthase
  Component type
   CNE_1c23240 (fabI2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AEI77651
UniProt: G0F0M2
LinkDB All DBs
Position
1:2410325..2411113
Genome map
AA seq 262 aa AA seqDB search
MGFLAGKRILITGLLSNRSIAYGIASACKREGAELAFTYVGERFKDRISDFAKEFGTDLV
FECDVGSDEQIAATFAALGQRWEKFDGLVHSIGFAPRDAIAGDFLEGLSREGFRIAHDIS
AYSFPALAKAALPLLSDKASLLTLTYLGAERVVPNYNTMGLAKASLEASVRYLASSVGPR
GIRANGISAGPIKTLAASGIKGFGKLLGHFEDVAPLRRNVTIEEVGNVAAFLLSDLASGV
TGEITYVDGGFNVVGASVADAE
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggatttctggcaggtaagcggatcctgatcaccggcttgctctctaaccggtcgatc
gcctatggcatcgcatcggcgtgcaaacgcgaaggcgccgaactggccttcacctatgtc
ggcgaacggttcaaggaccggatcagcgactttgccaaggaattcggcaccgacctggta
ttcgagtgcgacgtcggcagcgacgagcagatcgccgcgaccttcgccgcgctgggccag
cgctgggagaagttcgacgggctggtgcactcgatcggcttcgcgccgcgcgacgccatc
gccggcgacttcctggaaggcctgtcgcgcgaaggtttccgtatcgcccatgacatttcc
gcctacagcttcccggcgctggccaaggccgcgctgccgctgctgtcggacaaggcctcg
ctgctgacgctgacctacctgggtgccgagcgcgtggtccccaactacaacaccatgggc
ttggccaaggcctcactggaagccagcgtacgctacctggcctcgtcggtcggcccgcgc
ggcatccgcgccaacggcatctcggccggcccgatcaagaccctggccgcctcgggcatc
aagggcttcggcaagctgctcggccatttcgaagacgtcgcaccgctgcgccgcaacgtc
accatcgaagaagtcggcaacgtggccgccttcctgctgtccgacctggccagcggcgtg
accggtgagatcacctatgtcgacggcggcttcaacgtggtcggcgcaagcgtcgcggac
gcagagtaa

DBGET integrated database retrieval system