KEGG   Cupriavidus necator N-1: CNE_1c27150Help
Entry
CNE_1c27150       CDS       T01564                                 

Gene name
kynU
Definition
(GenBank) kynureninase KynU
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00380  Tryptophan metabolism
cnc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    CNE_1c27150 (kynU)
Enzymes [BR:cnc01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     CNE_1c27150 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AEI78030
UniProt: G0ET24
LinkDB All DBs
Position
1:2814112..2815368
Genome map
AA seq 418 aa AA seqDB search
MTTFDREHCIRLDERDPLRPLRDQFALPEGVIYLDGNSLGARPRAAAARAAQVVAEEWGE
GLIRSWNTAGWFELPQRLGNKLAPLVGAGQDEVVVTDTTSINLFKVLAAALRVQQTRDPA
RKVIVSEASNFPTDLYIAQGLADLLQQGYSLRLVNSPAEIDAAVGADTAVLMLTHVNYKT
GEMLDMAALTDLAHARGALTVWDLCHSAGAVPVNLKAAGADYAIGCTYKYLNGGPGSPAF
VWVAPALRDAFWQPLSGWWGHAAPFAMEPQYRPVDGVRRFLCGTQPVTSLAMVECGLDIF
AQTTMQVLRAKSLLLTDLFIELVEARCGHHPLTLVTPREHARRGSQVSLEHPDGYALVQA
LIERGVIGDYREPRIARFGFTPLYTSFTEVWDAVEILRDVLDSGAYRDARFQTRGQVT
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatttgaccgcgagcactgtattcggctcgatgagcgagacccgctgcgcccg
ctgcgcgaccagttcgcgctgcccgagggcgtgatttacctcgacggcaactcactgggc
gcccgcccgcgcgccgccgccgcgcgcgccgcccaggtggtggccgaagaatggggcgag
ggcctgatccgcagctggaacaccgccggctggttcgagctgccgcagcggctgggtaac
aagctggccccgctggtcggcgcgggccaggatgaagtggtggtgaccgacaccacctcg
atcaacctgttcaaggtgctggccgcggcgctgcgcgtgcagcagacgcgcgacccggcg
cgcaaggtgatcgtgtcggaggccagcaacttccccaccgacctgtacatcgcgcagggc
ctggccgacctgctgcagcagggctattcgctgcgcctggtcaattcgccggccgagatc
gacgccgccgtgggcgccgataccgccgtgctgatgctcacccacgtcaactacaagacc
ggcgagatgctggacatggccgcgctgaccgatctggcccatgcccgcggcgcgctcacg
gtgtgggacctgtgccactccgccggcgccgtgccggtcaacctgaaggcggccggggcc
gactacgccatcggctgcacctacaaatacctgaacggcggcccgggctcgcccgccttc
gtctgggtcgcgccggcgctgcgcgatgccttctggcagccactgtcgggctggtggggc
catgccgcgccgttcgcgatggagccgcagtaccgcccggtcgacggcgtgcgccgcttc
ctgtgcggcacgcagccggtgacttcgctggcgatggtggaatgcggcctggacatcttc
gcccagaccacgatgcaggtgctgcgcgccaagtcactgctgctgaccgacttgttcatt
gaactggtggaagcccgttgcggccaccacccgctgacgctggtcacgccgcgcgagcac
gcgcgccgcggcagccaggtcagcctggagcacccggacggctatgcgctggtgcaggcc
ctgatcgagcgcggcgtgatcggcgactaccgcgagccgcgcatcgcccgctttggcttc
acgccgctgtacaccagcttcaccgaggtgtgggatgctgtggaaatcctgcgcgatgtg
ctggacagcggcgcctatcgcgacgcgcggttccagacgcgcggccaggtgacctga

DBGET integrated database retrieval system