KEGG   Cupriavidus necator N-1: CNE_1c29390
Entry
CNE_1c29390       CDS       T01564                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc03030  DNA replication
cnc03430  Mismatch repair
cnc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CNE_1c29390 (holC)
   03430 Mismatch repair
    CNE_1c29390 (holC)
   03440 Homologous recombination
    CNE_1c29390 (holC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cnc03032]
    CNE_1c29390 (holC)
   03400 DNA repair and recombination proteins [BR:cnc03400]
    CNE_1c29390 (holC)
Enzymes [BR:cnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CNE_1c29390 (holC)
DNA replication proteins [BR:cnc03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CNE_1c29390 (holC)
DNA repair and recombination proteins [BR:cnc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     CNE_1c29390 (holC)
SSDB
Motif
Pfam: DNA_pol3_chi
Other DBs
NCBI-ProteinID: AEI78252
UniProt: G0EV12
LinkDB
Position
1:complement(3057308..3057742)
AA seq 144 aa
MTRIDFHSNVPDVLGYVCRLVRKAYGAGQKVVIHGAPAQLADLDARLWTFSALDFLPHCG
LESPNAAVTPILLAATTEGVPHHQLLINLADQAPAQFASFERLIEVVGAGDAAREAGRQR
YRFYRERGYPLTHHDIGQPKGDAA
NT seq 435 nt   +upstreamnt  +downstreamnt
atgacgcgcatcgatttccacagcaacgtgccggacgtgctcggctatgtctgccggctg
gtccgcaaggcctacggcgccgggcagaaggtggtgatccacggggcgccggcgcagctg
gcggacctggatgcgcgcctgtggaccttctccgcgctggacttcctgccgcattgcggg
ctggaaagccccaatgcggcggtcacgccgatcctgctggccgccaccaccgaaggcgtg
ccgcaccaccagctgctgatcaacctggccgaccaggccccggcgcagtttgccagcttc
gaacggctgatcgaggtggtgggcgcgggcgatgcggcgcgcgaggccggccgccagcgc
taccgtttctaccgcgaacgcggctatccgctgacgcaccacgacatcggccagcccaag
ggagacgccgcatga

DBGET integrated database retrieval system