KEGG   Cupriavidus necator N-1: CNE_2c01290Help
Entry
CNE_2c01290       CDS       T01564                                 

Gene name
acoA
Definition
(GenBank) acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit alpha
  KO
K21416  acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit alpha [EC:1.1.1.-]
Organism
cnc  Cupriavidus necator N-1
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CNE_2c01290 (acoA)
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     CNE_2c01290 (acoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N Transketolase_N
Motif
Other DBs
NCBI-ProteinID: AEI79120
UniProt: F8GNM7
LinkDB All DBs
Position
2:149536..150537
Genome map
AA seq 333 aa AA seqDB search
MTARASQDSAALPLDKETLLTVYRKMRTIRDFEERLHVDFGRGDIPGFVHLYAGEEAAGV
GILHHLNDGDRIASTHRGHGHCIAKGVDPVAMMKEIYGKKGGSCNGKGGSMHIADLSKGM
MGANGILGAGAPLICGAALAAKFRGKGEVGITFCGDGASNQGTFLESLNLAAVWNLPVIF
VIENNGYAESTSRDYGTAVDSYVDRAAGFGIPGVTVDGTDFFAVHEAAGEVIRRARDGGG
PSLLECKMVRFYGHFEGDAQTYRAAGELDDIRANKDCLKLFGRAVTQAGVVAREELDAID
REVAALIEHAVQEAKAAPQPGPEDLLTDVYVSY
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgacagccagagcttctcaagattccgccgcgctgccgctcgataaggagacgttgctg
acggtgtaccggaagatgcgcaccatccgcgattttgaagaacgcctgcacgtggacttc
gggcgcggcgacatcccgggcttcgtccacctgtacgcgggcgaggaagccgcgggcgtc
ggcatcctgcaccacctgaacgatggcgaccgcatcgccagcacgcaccgcggccacggc
cactgcatcgccaagggcgtcgatccggtggcgatgatgaaggagatctacggcaagaag
ggcggctcgtgcaatggcaagggcggctcgatgcatatcgccgacctgtccaagggcatg
atgggcgccaacggcatcctgggcgcgggcgcgccgctgatctgcggcgccgcgctggct
gccaagttccgcggcaagggcgaggtcggcatcaccttctgcggcgacggcgcctccaac
cagggcaccttcctggagagcctgaacctggccgcggtgtggaacctgccggtgatcttc
gtgatcgagaacaacggctatgccgaatcgacctcgcgcgattatggcaccgcggtggac
agctacgtggaccgcgccgccggcttcggcatcccgggcgtgacggtggacggcaccgat
ttcttcgccgtccatgaagcggccggcgaagtgatccggcgcgcgcgcgacggcggtggg
ccgtcgctgctcgaatgcaagatggtccgcttctacgggcacttcgagggcgatgcgcaa
acctaccgcgccgcaggcgaactcgacgatatccgcgccaacaaggattgcctgaagctg
tttggccgcgccgtgacccaggccggcgtggtcgcgcgcgaagaactcgacgccatcgac
cgcgaggtcgccgcgctgatcgagcatgccgtgcaggaggccaaggccgcaccgcagccc
gggcccgaagacctgctcaccgacgtctacgtcagctactga

DBGET integrated database retrieval system