KEGG   Cupriavidus necator N-1: CNE_2c10720Help
Entry
CNE_2c10720       CDS       T01564                                 

Gene name
sodC
Definition
(GenBank) u/Zn dependen superoxide dismutase SodC
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cnc  Cupriavidus necator N-1
Brite
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CNE_2c10720 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Big_3_5 HTH_IclR
Motif
Other DBs
NCBI-ProteinID: AEI80039
UniProt: F8GM20
LinkDB All DBs
Position
2:complement(1143117..1143701)
Genome map
AA seq 194 aa AA seqDB search
MKQVLTPLAACIAATIALAGCAGSGKTSSSAASASGASTSASASASARATATLQPKSGTN
TAGTVNFQQQPGGVMMTAAITGLPPSSVHGFHVHEKGDCSAPDAMSAGGHFNPTGKPHGQ
MTMPDHHAGDMNNVTADANGNVRVSMLLPDLTVGTGANGVIGRAVVVHKDPDDYKTQPTG
NAGGRIACGVVAAS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagtgcttacccccctggcggcctgcattgcagcgaccattgcactggccggc
tgcgccggctccggcaagacctcctcgtctgcagccagcgcgtccggcgccagcaccagc
gccagcgccagcgccagcgctagggcgacggccacgctccagcccaagagcggcaccaat
accgccggcaccgtgaacttccagcagcagccgggcggcgtgatgatgaccgcggcgatc
accggcctgccgcccagctcggtgcacggcttccacgtccatgagaagggcgactgctcg
gcgcctgacgcgatgagcgcgggcggccacttcaacccgaccggcaagccccacggccag
atgaccatgcccgaccaccacgccggcgacatgaacaacgtcaccgcggacgccaacggc
aacgtgcgcgtcagcatgctgctgccggacctgaccgttggcacgggcgccaacggcgtg
atcggccgcgcggtggtggtacacaaggacccggacgactacaagacgcagccgaccggg
aatgcgggcgggcggattgcttgcggcgtggtggcggcttcgtga

DBGET integrated database retrieval system