KEGG   Cupriavidus necator N-1: CNE_2c13530Help
Entry
CNE_2c13530       CDS       T01564                                 

Gene name
cbbL
Definition
(GenBank) ribulose bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00630  Glyoxylate and dicarboxylate metabolism
cnc00710  Carbon fixation in photosynthetic organisms
cnc01100  Metabolic pathways
cnc01120  Microbial metabolism in diverse environments
cnc01200  Carbon metabolism
Module
cnc_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cnc_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CNE_2c13530 (cbbL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CNE_2c13530 (cbbL)
Enzymes [BR:cnc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CNE_2c13530 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AEI80316
UniProt: F8GNE1
LinkDB All DBs
Structure
PDB: 

Position
2:complement(1436950..1438410)
Genome map
AA seq 486 aa AA seqDB search
MNAPESVQAKPRKRYDAGVMKYKEMGYWDGDYEPKDTDLLALFRITPQDGVDPVEAAAAV
AGESSTATWTVVWTDRLTACDMYRAKAYRVDPVPNNPEQFFCYVAYDLSLFEEGSIANLT
ASIIGNVFSFKPIKAARLEDMRFPVAYVKTFAGPSTGIIVERERLDKFGRPLLGATTKPK
LGLSGRNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLFVMDAVNKASAATGEVKG
SYLNVTAGTMEEMYRRAEFAKSLGSVIIMIDLIVGWTCIQSMSNWCRQNDVILHLHRAGH
GTYTRQKNHGVSFRVIAKWLRLAGVDHMHTGTAVGKLEGDPLTVQGYYNVCRDAYTHTDL
SRGLFFDQDWASLRKVMPVASGGIHAGQMHQLIHLFGDDVVLQFGGGTIGHPQGIQAGAT
ANRVALEAMVLARNEGRDILNEGPEILRDAARWCGPLRAALDTWGDISFNYTPTDTSDFA
PTASVA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacctgaatcggtccaagccaagccgcgcaagcgctacgacgccggcgtcatg
aagtacaaggaaatggggtactgggacggcgactacgagcccaaggataccgacctgctg
gcgctgttccgcatcacgccgcaggacggcgtggatccggtcgaggccgctgccgcggtg
gcgggcgaatcctccaccgccacctggacggtggtgtggaccgaccgcctgaccgcctgc
gacatgtaccgcgccaaggcctaccgggtcgatccggtgcccaacaaccccgagcagttc
ttctgctacgtggcctatgacctgtcgctgttcgaggaaggctcgatcgccaacctgacc
gcgtcgatcatcggcaacgtcttcagcttcaagccgatcaaggcggcgcgcctggaagac
atgcgcttcccggtggcctatgtgaagaccttcgccggcccgtccaccggcatcatcgtc
gagcgcgagcgcctggacaagttcggccgcccgctgctgggcgccaccaccaagcccaag
ctgggcctgtcgggccgcaactacggccgcgtggtgtatgagggcctgaagggcgggctg
gacttcatgaaggatgacgagaacatcaactcgcagcccttcatgcactggcgcgaccgc
ttcctgttcgtgatggacgcggtcaacaaggcctcggccgccaccggcgaggtcaaaggc
agctatctcaacgtgaccgccggcaccatggaagagatgtaccggcgtgccgagttcgcc
aagtcgctgggctcggtcatcatcatgatcgacctgatcgtcggctggacctgtatccag
tccatgagcaactggtgccggcagaacgacgtgatcctgcacctgcaccgggcgggccat
ggcacctacacccggcagaagaaccacggcgtgtcgttccgcgtgattgccaaatggctg
cgcctggcaggcgtcgaccacatgcacaccggcaccgcggtgggcaagctggaaggcgac
ccgctgaccgtgcagggctactacaacgtttgccgtgatgcctacacccacaccgacctg
tcgcgcgggctgttcttcgaccaggactgggcttcgctgcgcaaggtgatgccggtggcc
tccggcggcatccatgccggccagatgcaccagctgatccacctctttggcgacgatgtg
gtgctgcagttcggcggcggcaccatcggccacccgcagggcatccaggccggcgccacc
gccaaccgcgttgcgctggaagccatggtgctggcgcgcaacgaaggccgcgacatcctc
aacgaagggccggagatcctgcgcgatgccgcgcgctggtgcggaccgctgcgggctgcg
ctcgatacctggggcgacatcagcttcaactacacgccgaccgacacctcggacttcgcg
cccaccgcgtcggtggcctga

DBGET integrated database retrieval system