KEGG   Cupriavidus necator N-1: CNE_2c18920Help
Entry
CNE_2c18920       CDS       T01564                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00020  Citrate cycle (TCA cycle)
cnc00480  Glutathione metabolism
cnc01100  Metabolic pathways
cnc01110  Biosynthesis of secondary metabolites
cnc01120  Microbial metabolism in diverse environments
cnc01130  Biosynthesis of antibiotics
cnc01200  Carbon metabolism
cnc01210  2-Oxocarboxylic acid metabolism
cnc01230  Biosynthesis of amino acids
Module
cnc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cnc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CNE_2c18920 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CNE_2c18920 (icd)
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CNE_2c18920 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH B12-binding_2
Motif
Other DBs
NCBI-ProteinID: AEI80848
UniProt: F8GRI3
LinkDB All DBs
Position
2:complement(2037661..2039934)
Genome map
AA seq 757 aa AA seqDB search
MSHHPFEDLREAMSNQQPTIIYTLTDEAPLLATSAFLPIIQTFTKPAGINVTTSDISVAG
RILGEFPEFLTEAQRVPDNLAELGKLTQLPDTNIIKLPNISASVHQLVSAIRELQGKGYK
VPDYPEDPKTDEEKAIQKRYSKCLGSAVNPVLREGNSDRRAPAAVKNFARKHPHSMGEWS
MASRTHVAHMKHGDFYHGEKSMTLDKARDVKMELVTKSGKTIVLKPKVSLLDGEIIDSMF
MSKKALCDFYEEQFEDARKTGVMLSLHVKATMMKVSHPIVFGHAVKIFYKEAFAKHGALF
DELGVNVNNGLVNLYEKIEALPSSKREEIIRDLHACHEHRPELAMVDSAKGISNLHAPND
VIVDASMPAMIRIGGKMWGADGRPKDTKAVIPESTFARIYQEIINFCKTNGNFDPTTMGT
VPNVGLMAQKAEEYGSHDKTFEIAEDGVANIVDLATGEVLLTQDVEQGDIWRMCQVKDAP
IRDWVKLAVTRARNSGMPAVFWLDPYRPHEAELIKKVEAYLKGYDTTGLDIQIMSQVRAM
RYTLERVIRGLDTISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGS
APKHVKQLVEENHLRWDSLGEFLALAVSLEDVGIKTGNARAKILAKTLDAATGKLLDNNK
SPSPKTGQLDNRGSQFYLAMYWAQELAVQSDDAELATKFAPLAKTLTDNEQKIVGELGAV
QGKPVDIGGYYMPEADKLSAAMRPSQTLNAALSTVTA
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaccacccgttcgaggatctgagagaagcaatgagtaaccagcaacccaccatc
atctacacgctgaccgacgaagctccgctgctggcgaccagtgcgttcctcccgatcatc
cagaccttcaccaagccggccggcatcaacgtgaccaccagcgatatctcggtggccggc
cgtatcctgggcgaattccccgaattcctgaccgaagcacagcgcgtgccggacaacctg
gccgagctgggcaagctgacgcagctgccggacaccaacatcatcaagctgcccaacatc
agcgcctcggtgcaccagctggtgagcgccatccgtgaactgcagggcaagggctacaag
gtgccggactatccggaagacccgaagaccgacgaagaaaaggccatccagaagcgctac
tccaagtgcctgggcagcgccgtgaacccggtcctgcgcgagggcaactccgaccgccgc
gcaccggcagcggtcaagaacttcgcgcgcaagcacccgcacagcatgggcgagtggagc
atggcttcgcgcacgcacgtggcgcacatgaagcatggtgacttctaccacggcgaaaag
tccatgaccctggacaaggcgcgtgacgtcaagatggaactggtcaccaagagcggcaag
accatcgtgctcaagcccaaggtctcgctgctggatggcgagatcatcgacagcatgttc
atgagcaagaaggcgctgtgcgacttctatgaagagcagttcgaagacgcgcgcaagacc
ggcgtgatgctgtcgctgcacgtcaaggcgaccatgatgaaggtgtcgcacccgatcgtg
ttcggccacgccgtcaagatcttctacaaggaagcctttgccaagcacggcgcgctgttc
gatgaactgggcgtgaacgtcaacaacggcctggtcaacctgtacgagaagatcgaggcg
ctgcccagctccaagcgcgaagagatcatccgcgacctgcacgcctgccacgagcatcgc
ccggaactggccatggtggattcggccaagggcatctccaacctgcacgcgcccaacgac
gtgatcgtcgatgcctcgatgccggccatgatccgcatcggcggcaagatgtggggtgcc
gacggccgtccgaaggacaccaaggccgtgatcccggaaagcacctttgcccgcatctac
caggagatcatcaacttctgcaagaccaacggcaacttcgacccgaccaccatgggcact
gtgcccaacgtgggcctgatggcgcagaaggccgaagaatacggctcgcacgacaagacc
ttcgagatcgccgaagacggcgtcgccaacatcgtcgacctggccaccggtgaagtgctg
ctgacgcaggacgttgagcagggcgacatctggcgcatgtgccaagtcaaggatgcgccg
atccgcgactgggtcaagctggccgtcacgcgcgcgcgcaactcgggcatgccggccgtg
ttctggctggacccgtaccgtccgcacgaggccgagctgatcaagaaggtcgaggcctac
ctgaagggctacgacaccaccggcctggacatccagatcatgtcgcaggtgcgcgccatg
cgctacacgctggagcgcgtgatccgcggcctggacaccatctcggtgactggcaacatc
ctgcgcgactacctgaccgacctgttcccgatcatggaactgggcaccagcgccaagatg
ctgtcgatcgtcccgctgatggccggcggcggcatgtatgaaaccggcgccggcggttcg
gcaccgaagcacgtcaagcagctggtggaagagaatcacctgcgctgggattcgctgggc
gagttcctggcgctggcggtgtcgctggaagacgtgggcatcaagaccggcaacgcgcgc
gccaagatcctggccaagacgctggatgctgctaccggcaagctgctggacaacaacaag
agcccgtcgcccaagaccggccagctggacaaccgcggcagccagttctacctggcgatg
tactgggcgcaggaactcgccgtccagtcggacgacgcggaactggccaccaagtttgcg
ccgctggccaagacgctgaccgacaacgagcagaagatcgttggcgaactgggcgccgtg
cagggcaagccggtggatatcggcggctattacatgccggaagccgacaagctcagcgcc
gcaatgcgcccgagccagacgctgaacgccgcgctgtcgaccgtgacggcctga

DBGET integrated database retrieval system