KEGG   Cupriavidus necator N-1: CNE_2c19240Help
Entry
CNE_2c19240       CDS       T01564                                 

Gene name
acoD
Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00010  Glycolysis / Gluconeogenesis
cnc00620  Pyruvate metabolism
cnc01100  Metabolic pathways
cnc01110  Biosynthesis of secondary metabolites
cnc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNE_2c19240 (acoD)
   00620 Pyruvate metabolism
    CNE_2c19240 (acoD)
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     CNE_2c19240 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AEI80880
UniProt: F8GRL5
LinkDB All DBs
Position
2:2073645..2075165
Genome map
AA seq 506 aa AA seqDB search
MNMAEIAQLGVNNPYKQQYENYIGGAWVPPAGGEYFESITPITGKPFTRVPRSGQQDVDA
ALDAAHAAKAAWAHTSTTERANILNRIADRIEANLKLLAVAESIDNGKPVRETTAADLPL
AVDHFRYFAGCIRAQEGGISEIDADTIAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALA
AGNCVVLKPAEQTPASILVLMEVIGDLLPPGVINVINGFGLEAGKPLASSPRISKVAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFEDVLAADDAFFDKALEGFAMFALNQGEV
CTCPSRALIQESIYDRFMERALKRVAAIRQGHPLDTGTMIGAQASAEQLEKILSYIDLGR
KEGAQCLTGGERNVLDGDLAGGYYVKPTVFAGHNKMRIFQEEIFGPVVSVTTFKDEEEAL
AIANDTLYGLGAGVWTRDGARAFRMGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HRMMLDHYQQTKNLLVSYSPNALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggcggaaatcgcccagctgggcgtcaacaacccctacaagcagcagtacgag
aactacatcggcggcgcctgggtgccgcccgccggcggcgagtacttcgaatcgatcacc
ccgatcaccggcaagccgttcacgcgcgtgccgcgctccggccagcaggatgtcgacgca
gcgctggacgccgcgcatgccgccaaggccgcgtgggctcacacctccaccaccgagcgc
gccaatatcctgaaccgcatcgccgaccgcatcgaggccaacctgaagctgctggcagtg
gccgagagcatcgacaacggcaagccggtgcgcgaaaccaccgccgccgacctgccgctg
gcggtcgaccacttccgctactttgccggctgcatccgtgcgcaggaaggcggcatctcc
gagatcgacgccgacaccattgcctaccatttccatgagccgctgggcgtggtcggccag
atcatcccgtggaacttcccgctgctgatggccacctggaagctggccccggcgctggcc
gccggcaactgcgtggtgctcaagccggcggaacagacgccggcctcgatcctggtgctg
atggaagtgatcggcgacctgctgccgccgggcgtgatcaatgtgatcaacggcttcggg
ctggaagccggcaagccgctggcatcaagcccgcgcatcagcaaggtggcgttcaccggc
gagaccaccaccggccggctgatcatgcagtacgcgtcgcagaacctgatcccggtgacg
ctggagctgggcggcaagtcgcccaacatcttcttcgaggacgtgctggccgccgacgac
gccttcttcgacaaggcgctggaaggctttgccatgttcgcgctgaaccagggcgaagtc
tgcacctgcccgtcgcgcgcgctgatccaggaatcgatctacgaccgcttcatggagcgc
gcgcttaagcgcgtggccgcgatccgccagggccatccgctcgacaccggcaccatgatc
ggcgcgcaggcgtccgccgaacaactggagaagatcctgtcgtacatcgacctgggccgc
aaggaaggcgcgcagtgcctcaccggcggcgagcgcaacgtgctggacggcgacctcgcg
ggcggctactacgtcaagccaacggtgtttgccggccacaacaagatgcggatcttccag
gaagagatcttcgggccggtggtgtcggtgaccaccttcaaggacgaggaagaggcgctg
gccatcgccaacgacacgctctacgggctcggtgcgggtgtctggacacgtgacggcgcg
cgcgcattccgcatgggccgcggcatccaggcggggcgcgtgtggaccaactgctaccac
gcctaccccgcgcatgccgcattcgggggctacaagcagtccggcatcggccgcgagaac
catcgcatgatgctcgaccactaccagcagaccaagaacctgctggtgagctacagcccc
aacgcgctcgggttcttctga

DBGET integrated database retrieval system