KEGG   Cupriavidus necator N-1: CNE_2c24090Help
Entry
CNE_2c24090       CDS       T01564                                 

Gene name
fabG13
Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] reductase FabG
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00061  Fatty acid biosynthesis
cnc00780  Biotin metabolism
cnc01100  Metabolic pathways
cnc01130  Biosynthesis of antibiotics
cnc01212  Fatty acid metabolism
Module
cnc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CNE_2c24090 (fabG13)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CNE_2c24090 (fabG13)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CNE_2c24090 (fabG13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cnc01004]
    CNE_2c24090 (fabG13)
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     CNE_2c24090 (fabG13)
Lipid biosynthesis proteins [BR:cnc01004]
 Fatty acid synthase
  Component type
   CNE_2c24090 (fabG13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Glyco_transf_4 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AEI81356
UniProt: F8GMC8
LinkDB All DBs
Position
2:2603856..2604587
Genome map
AA seq 243 aa AA seqDB search
MTNPTVLVTGSSRGIGRAIALRLARDGYDVVVHCRSRRDEADSVADAVRACGRKARVLCF
DVARREEAAAALLADIAAHDCYYGVVCNAGLARDAAFPAMSGAEWDEVVHTNLDAFYNVL
NPVVMPMVQRRQPGRIVTLSSVSGLVGNRGQTNYSAAKAGIIGATKALAIELAKRAITVN
CVAPGLIDTDMVEQHVRNEALRMIPARRLGTPDEVAATVAFLMSPDAGYITRQVISVNGG
MFG
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatccgaccgtgctcgttacgggctcgtcgcgcggcatcggtcgcgccatcgcc
ctgcggctggcccgcgacggctacgacgtggtggtgcattgccgctcgcgccgcgacgaa
gccgactccgtcgccgacgcggtgcgcgcctgcggccgcaaagcccgcgtgttgtgcttc
gacgtggcccggcgcgaggaagccgccgccgcgctgctggccgatatcgccgcgcatgac
tgctactacggcgtggtatgcaacgccggcctggcgcgcgacgcggccttcccggccatg
agcggcgccgaatgggacgaggtggtgcataccaacctcgacgccttctacaacgtgctc
aacccggtggtgatgccgatggtgcagcggcgccagcccgggcgcatcgtcacgctctcg
tcggtctcgggcctggtgggcaaccgcggccagaccaactacagcgcggccaaggccggc
atcatcggcgccaccaaggcgctggcgatcgaacttgccaaacgcgccatcacggtcaac
tgcgtggcgcccggcctgatcgacaccgacatggtcgagcagcacgtgcgcaacgaggcg
ctgcgcatgatcccggcgcggcggctcggcacgcccgacgaagtggccgcgaccgtggcc
ttcctgatgtcgcccgacgccggctatatcacgcgccaggtgatctcggtcaacggcggg
atgttcggatga

DBGET integrated database retrieval system