KEGG   Cupriavidus necator N-1: CNE_BB1p01200Help
Entry
CNE_BB1p01200     CDS       T01564                                 

Gene name
alr
Definition
(GenBank) alanine racemase Alr
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00473  D-Alanine metabolism
cnc01100  Metabolic pathways
cnc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CNE_BB1p01200 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CNE_BB1p01200 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cnc01011]
    CNE_BB1p01200 (alr)
Enzymes [BR:cnc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CNE_BB1p01200 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cnc01011]
 Precursor biosynthesis
  Racemase
   CNE_BB1p01200 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEI81547
UniProt: F8GVI8
LinkDB All DBs
Position
BB1p:complement(114395..115513)
Genome map
AA seq 372 aa AA seqDB search
MENNAWVEVDLGKFEANVRGIQTRIGDRAEMCAVMKADACGHGIALLVPTLVALGVSSIG
IARNDEARQVRQAGFTGRLLRVRAATLAEIEDGLPYGLEEIVGNLDYARHIDALVHRYRR
VARVHLELNSGGMSRNGFDLDSQPEREKCLAAAALPHLRVVGIMTHFPVQEVSDVERGLA
RFRDEAAWLIASASMVRSQIQLHCANSFTTLEVPAAHLDMVRTGAILFGCLPAYPDFQPI
ASLKSRVASVNAYAAGNTVAYDRTLCLSRDSRLANIPVGYADGYRRALSNRGQALIRGRV
YPVVGRVTMNTLMVDVTESPDILPGDEVVLFGTQGGSRIDVASIEAAAGTIYPDLCVGWG
NSVTRVAVPANH
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaacgcatgggtggaggtggacctcggcaagtttgaggccaacgtccggggc
atacagacgcgtatcggcgatagagccgagatgtgtgccgtgatgaaggcggatgcctgc
gggcacggtatcgcgctgctggtgcctacgctggttgctcttggtgtgtcgtcaatcggc
atcgcgaggaatgacgaggcgcggcaggtccgccaagctggcttcacgggccgtctactg
cgcgtacgcgccgccacgctggctgaaattgaagacggactgccatatggtctggaagaa
attgtcggcaacctcgactacgcccggcacatcgacgcccttgtgcaccgctaccggcgc
gtggcccgcgtgcacctggaactgaactccggcggcatgagccgcaatggcttcgacctc
gactcgcaaccggagcgcgagaagtgcctggccgccgccgcattgccacacctacgggtg
gtcggcatcatgacccatttccccgtacaggaggttagcgacgtcgaacgcggcctcgcg
cgtttccgggatgaagccgcatggctgattgccagcgccagcatggtgcgcagtcagatc
cagctacactgcgccaactcttttaccacgctggaagtgccggctgcccacctggacatg
gtacgcacaggtgccatactgtttggctgcctgccagcctatccggacttccagccaatc
gccagccttaagtcgcgcgtggcgtcggtgaatgcctatgccgctggcaacaccgtagcc
tacgaccgcaccctgtgtctgtcgcgcgattcgcggcttgccaatatccccgtcggatat
gccgatggctatcggcgcgcgttatcgaaccgcggccaagcactgattcgcggcagggtc
taccctgtggtggggcgcgtgactatgaacacgctgatggtcgacgtcaccgaaagcccc
gacatcctgcccggcgacgaggtggtgctattcggaacacagggcggctcgcgcatcgac
gtggccagcatcgaagccgcagccggcacgatctatccggatctttgcgttggctgggga
aactctgtcacgcgagtcgccgttccggccaatcactag

DBGET integrated database retrieval system