KEGG   Cryptococcus neoformans var. neoformans JEC21: CNA01050Help
Entry
CNA01050          CDS       T00243                                 

Definition
(RefSeq) sorbitol dehydrogenase, putative
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00040  Pentose and glucuronate interconversions
cne00051  Fructose and mannose metabolism
cne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CNA01050
   00051 Fructose and mannose metabolism
    CNA01050
Enzymes [BR:cne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     CNA01050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 UDPG_MGDP_dh_N Methyltransf_25 PrmA 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 3253440
NCBI-ProteinID: XP_566539
UniProt: Q5KPZ2
LinkDB All DBs
Position
1:complement(join(287441..287723,287787..287956,288010..288351,288417..288689,288754..288825))
Genome map
AA seq 379 aa AA seqDB search
MSTELNPDNTSFVLHGVEDVRFDQRPIPEVHNDQVLIKVVKTGICGSDVHYLQHGRIGSF
VLEEPMCLGHESAGVVVKLGPNVREDLGVEVGTRVAMEPGVCCRSCANCKAGLYELCPYM
SFAATPPTIFGTLCRYYVLPADLVHPLPESVSFEDGAMMEPLSVGVHSVATLGGCKSDQT
VIVFGAGPVGLLCMAVAKALGARRIIAVDINKERLEFAKSYAATDVCIPGSKLDGEDGEA
YTARIAGELRQELGIPERGKGAIDLAIEASGAPTCVQIGLAVLKPAGTYVQVGMGAKMTV
PVPLFHIISKQLHVVGSFRYGSGDYPLAISLVERGLIDLKPLVTQRFKFENAKEAFETTK
VGKDKNGKGVIKCIIDGPE
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccgaactcaacccagacaacaccagctttgtcctccacggcgtcgaagacgtc
aggttcgaccagcgtcccatccccgaggtccacaatgaccaagtcctcatcaaggtcgtc
aagactggtatctgcggctctgatgtgcactaccttcagcatggacgtatcggctctttt
gtcctcgaggaacccatgtgtctgggtcacgagtcagctggtgtcgtcgtcaagctcggt
cctaacgtgagagaggatctaggtgtcgaagttggcaccagagtggctatggagcctggt
gtttgctgtaggtcttgtgccaattgtaaagctggcttgtacgagctctgtccttacatg
agctttgccgctactccccctaccatctttggtacactctgtcgatactatgtgctccct
gctgaccttgtccaccctcttcccgaatccgtttcctttgaggatggtgctatgatggaa
cccctctccgtcggtgtccactctgtggccaccttgggagggtgcaagtctgaccagaca
gtcattgtctttggtgccggacccgttggactgttgtgtatggctgttgccaaggccctg
ggagcgaggaggattattgctgtggatatcaacaaggaaagactggaattcgccaagagt
tacgctgccactgatgtctgcatacctggttctaaattggacggcgaagacggagaagcg
tacaccgcccgaatagctggtgaacttcgtcaggagctcggcattcccgagcgaggaaag
ggtgccatcgatctcgccatcgaagcatccggtgcgcctacttgtgttcaaatcggtttg
gccgtgttgaaacctgccggcacttacgtccaagttggtatgggcgccaagatgaccgtc
cccgttcccctcttccacatcatctccaagcaactccacgttgtcggttccttcagatac
ggttccggcgactaccctttggccatttcacttgttgaaaggggattgatcgacttgaag
ccgttggtcactcagaggttcaagtttgaaaatgccaaagaggcgtttgagaccacaaag
gttggaaaagacaagaatgggaagggcgtgatcaagtgtatcatcgatggaccggagtaa

DBGET integrated database retrieval system