KEGG   Cryptococcus neoformans var. neoformans JEC21: CNA03840Help
Entry
CNA03840          CDS       T00243                                 

Definition
(RefSeq) protein serine/threonine kinase, putative
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne04113  Meiosis - yeast
cne04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:cne00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    CNA03840
  09143 Cell growth and death
   04113 Meiosis - yeast
    CNA03840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cne01001]
    CNA03840
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cne03019]
    CNA03840
   03036 Chromosome and associated proteins [BR:cne03036]
    CNA03840
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CNA03840
Protein kinases [BR:cne01001]
 Serine/threonine kinases: AGC group
  PKA family
   CNA03840
Messenger RNA biogenesis [BR:cne03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CNA03840
Chromosome and associated proteins [BR:cne03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    CNA03840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 3253859
NCBI-ProteinID: XP_024512056
LinkDB All DBs
Position
1:complement(join(1031767..1031851,1031917..1032146,1032197..1032253,1032309..1032391,1032443..1032647,1032698..1032962,1033009..1033220,1033261..1033501,1033555..1033727))
Genome map
AA seq 516 aa AA seqDB search
MFQKVSDKFHRKQQSTTLPGKTQQVPNPTSPVLAKANSQAQQAYSLPQDHSPMEGIQRDS
PPIQQPMATEKAPIVGSSASTSLPTLSVQDGTLPLTPGAQGMQTGTIDGHRQLQSPVSRS
SSAGEDKMREKARDAQEQAAQSQANLHHATQQARVAAINAAATQAALETAAQLPATARVP
VSGGGVEQGQARRKTAGRYALSDFLIERTLGTGSFGRVHLVRSRHNGRFYAVKVLNKEKV
IKMKQVEHTNSEREMLVRVRHPFLVNLWGTFQDVNNLYMVMDFVAGGELFSLLRKSQRFP
NSVAKFYAAEVALALDYLHSLDIIYRDLKPENLLLGADGHVKVTNFGFAKYVPDITWTLC
GTPDYLAPEVVQSKGYNKSVDWYALGVLIFEMLAGYPPFFTEDGNPMKLYEKIIAGKVRY
PTYFDALAKELLKNLLIGDLTKRYGNLRAGSSDIFAHGWFAEVDWDKLYRREIPAPYVPK
IDGEGDASQFDRYQEADVSAYGKVGNGPYDHFFTEF
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttccaaaaggtgtccgataagttccatcgcaaacagcagtccacgacattacccggt
aaaacgcaacaggttcctaaccctaccagtccagtcctggcgaaagccaattctcaagct
caacaagcatattctttgcctcaagatcattccccgatggaaggtatacaaagggattcc
ccgcctatccaacagcctatggctactgaaaaggcacccatagttggatcttctgcatcg
acgtctttacccaccctatccgtgcaagatggcactcttccattgactccaggtgctcag
gggatgcagacaggcacaatcgacgggcatcggcaacttcagagtcctgtgtctcgtagt
agtagtgcaggcgaggataagatgagagaaaaggcgagggatgcccaggagcaggcagcg
caatcccaggccaacctccatcacgcaacgcaacaagcgcgcgttgccgccatcaatgcc
gccgctactcaagctgcccttgaaacagccgcccagctgcccgcaactgctagggtccca
gtttccggtgggggagttgagcagggtcaagcaaggcgcaaaacagctggccgatatgct
ctatctgatttccttattgaaagaactttgggcaccgggtccttcggacgtgtgcattta
gtgcggtcacgccacaacggtcgcttctatgccgttaaggttctgaacaaggagaaggtt
atcaagatgaagcaagttgaacacaccaattctgaacgagagatgttggtgcgggttcga
cacccatttctcgtcaacctctggggaacctttcaggatgtgaataacctgtatatggtc
atggacttcgtggcaggaggtgaactctttagccttcttcgtaaaagtcagcgattcccg
aattctgtcgcgaaattctacgcagccgaagttgctttagcgctcgactatcttcattca
ctcgatattatctaccgagatcttaagccagaaaatctacttttgggtgcagatggccat
gtcaaggttaccaactttggttttgccaagtatgtacctgatatcacctggactctttgc
gggacaccggattaccttgctccggaggttgttcagtccaagggttataacaaaagcgtc
gattggtacgctttaggggtattaatatttgaaatgctggcgggttatcctcccttcttc
accgaagacggcaatccaatgaaattgtatgagaagatcattgctggcaaagtccgctat
ccgacatactttgacgcacttgcgaaagaactcttaaaaaatctactgatcggggacctc
actaagcgatacggtaatttgagagcgggctcttctgatatatttgcccatgggtggttc
gcagaagtcgactgggacaagctgtacaggcgcgaaatcccggctccatatgtgcccaag
attgacggcgaaggagacgctagccagttcgatcgctaccaagaggcggatgttagtgct
tatgggaaggttggcaacggtccatatgatcatttcttcacggagttttag

DBGET integrated database retrieval system