KEGG   Cryptococcus neoformans var. neoformans JEC21: CNA05480Help
Entry
CNA05480          CDS       T00243                                 

Definition
(RefSeq) DNA ligase, putative
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne03030  DNA replication
cne03410  Base excision repair
cne03420  Nucleotide excision repair
cne03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cne00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CNA05480
   03410 Base excision repair
    CNA05480
   03420 Nucleotide excision repair
    CNA05480
   03430 Mismatch repair
    CNA05480
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cne03032]
    CNA05480
   03400 DNA repair and recombination proteins [BR:cne03400]
    CNA05480
Enzymes [BR:cne01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CNA05480
    6.5.1.6  DNA ligase (ATP or NAD+)
     CNA05480
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CNA05480
DNA replication proteins [BR:cne03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CNA05480
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CNA05480
DNA repair and recombination proteins [BR:cne03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CNA05480
   NER (nucleotide excision repair)
    Other NER factors
     CNA05480
   MMR (mismatch excision repair)
    Other MMR factors
     CNA05480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_N DNA_ligase_A_M DNA_ligase_A_C CAF1-p150_N
Motif
Other DBs
NCBI-GeneID: 3253216
NCBI-ProteinID: XP_566872
UniProt: Q5KNS4
LinkDB All DBs
Position
1:join(1469506..1470185,1470253..1470664,1470725..1470742,1470793..1471301,1471366..1471684,1471742..1472132,1472189..1472341,1472394..1472556,1472607..1472796)
Genome map
AA seq 944 aa AA seqDB search
MPADSKVKRGAKPQATPITPPSKKFKQAAVTQQRPISSFFHSPVKSSIKGKEVIIIEDSD
SDDYPESSTQAAIAHDGNGDVESSRNHVLQLPEENQISSLSCVKEKDGHGMASTSKVFHE
RSKTTPNGTAISSRTEGQSDRVHYFSRKSQRTITGDEPVPPSSITTCASEDSVQNIDFDR
DPLAFDPSRVIATSWPKGRLPYSILVSVYVQLSSTKSRLAIVRILTNFLHLLMHTSPPDL
TPCLYLLSNHLTPSYIHCDLGIGSSILSKSIQEISGLQARDLKHLWQKYGDPGDVAFEAK
NKLRTLVQPAPLLAGEVYDKLLEIAKVKGSNSGKIKNELVRKLLIRAKGEEVRFLVRSIV
GNLRIGAVRLTLLTALARATTITRLPADLKQSIIPLPRATANDGRNDKRSVITKAPPDVA
RDSAETLCLDAIRIVRKVYVRHPNYEDLVAGLKEGVESLEDKVPVSVGIPLSPMLGSITR
SLNEVFTRLGHLSFTAEAKLDGQRGQLHIRLDGPEGKDDGGGRWVYADNGTKVWVRLFSR
HLEDMTDKYPDICHLALDLLSRPLATERPPFPAVSSRPFSRVIDLLHINNITSVVMDTEI
VALDKDTGNFRTFQELSNRAKKDVKMEEIKVIVGVFAFDLMVLNDVSLLDVPFSHRRHLL
HSLLPPFAPNSNEVGHPVARFTHVEYIDSVHLTDPEAELQAFFERVVEKKCEGLMVKLLE
NGEGLAGEEATEDSLGQEGGLEVKSEQKNGSKSKRQPLPATYEPDQRSQGWLKVKKDYLE
GLGDSLDLVPIGAWWGQGRKAGWWSPILLACHNPDSGALEAVCKCMSGFSDAFYKDLSKR
YPAEGMPSKCSKIAPIGFVNTNGLIPDVWFEPSEVWEIKGADITLSPVYPAASSHLGSER
GLSVRFPRFIRMRDDKTWEDAMTSDQLADMYRRQIKEGEKTTKN
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctgacagcaaagtcaaaaggggagcgaaaccacaggcaacacccatcacaccg
cccagtaagaaattcaagcaagcggctgtcacccaacaacgtcccatatcctcttttttt
cactcacctgttaaaagcagcatcaagggcaaggaggtcattatcatagaagattcagat
tcagatgattatcctgagtcctcaacccaggcggcgatagcacatgacgggaatggtgat
gtggaatcatccagaaaccatgttcttcaactacctgaagagaatcagataagctccctc
agctgtgtaaaggagaaagatggacatggtatggccagtacttcaaaagtttttcatgaa
agatcgaagacaacgcccaatgggacggctatctcgtcacgaacggaaggacaaagtgat
cgagtgcactacttctcccgaaaatcccagagaacaataactggggacgaacctgttcct
ccctccagtatcactacttgtgcttcagaagactcggttcaaaatatagattttgatcgc
gaccctctcgccttcgatccgtcccgggttatagcaacttcctggcccaagggtcgttta
ccgtacagtattctcgtcagcgtgtatgtacagctctccagtacaaagtcgcgattagct
atcgtacgaatcttaacaaacttccttcatttgctcatgcacacttcaccacctgatttg
acaccttgcctttatctcctttccaatcaccttaccccttcctacatccattgtgatctt
ggcattggatcttctatattgtccaaaagtatacaagaaatttcgggccttcaagctcgc
gatctcaaacacctatggcaaaaatatggcgatcctggcgatgttgctttcgaagcgaaa
aacaaactacgaactttggtgcaaccagctccgcttttggctggagaagtgtatgataag
ttgctggaaattgcgaaagtgaagggcagtaatagcgggaaaataaaaaatgagctagtc
agaaagttgttgattcgggccaaaggagaggaagtcagatttcttgtccgaagtatagta
ggcaacttgaggataggtgccgtcaggctgacccttctgaccgccttggcacgcgccacc
actataacacggcttccagctgaccttaagcagtctataataccccttccaagggctaca
gccaacgatggcaggaatgataaacgctcagtcattactaaagcacctccagacgttgcc
cgcgattccgcagagactctctgtctagatgccatacgcatagtacggaaagtgtatgta
cgacatccaaattacgaagatcttgtagccggcctcaaggaaggagttgaaagtttggag
gataaagtgcctgtgagcgtagggattccactgtctcccatgctggggtccatcacaaga
tcactgaacgaggtgttcacgagactgggacatctttcgtttacagcagaggcgaagtta
gatggtcagagaggacaacttcatatcagactggatggcccggaaggaaaagatgatgga
ggggggagatgggtttatgcggataatggtactaaagtttgggttaggctattcagcagg
cacttggaagacatgaccgacaagtaccccgatatctgtcacctagctcttgatcttctc
tcgcgaccccttgcaacagaaaggccgccattcccagccgtttccagtcgaccattttca
agagtcatcgatttactacacatcaataatatcacatcagtggttatggataccgagatt
gtagcactggacaaggataccggtaactttcgaacctttcaagaactgtctaacagagcg
aaaaaagacgtgaaaatggaggaaattaaagttatagttggggtctttgcttttgattta
atggtgctcaatgatgtctcattactggacgtccctttttcacatcggagacatctcctt
cacagtctgctcccccctttcgctcccaattcaaatgaagttggacacccagtggcacgt
ttcacacatgtcgaatacattgattctgtccatctcactgatcctgaggcggaattgcaa
gcattcttcgagagggttgtggaaaaaaagtgcgaaggcttgatggtcaaattgctggaa
aacggggaaggcttggctggggaagaggcgacagaagatagtttaggtcaagaagggggc
ctggaagttaagtcggagcagaagaatgggagtaagagtaagcgtcaacctcttcccgct
acatacgagccagatcagcgcagtcaaggttggctcaaggtaaagaaagattatctagaa
gggttaggggattctctcgatctcgtgcccattggcgcgtggtggggtcagggccgtaaa
gcgggttggtggagtcctattctcttagcctgccacaatcctgatagtggcgccctggaa
gcggtctgcaaatgcatgtccgggttttctgacgcattctacaaagatcttagcaagcgc
tatcctgccgaaggaatgccgagtaaatgcagcaaaatagcacctattggatttgtaaat
acgaacggcttaataccagacgtgtggtttgagcctagcgaagtatgggagattaaaggt
gctgacatcaccctctctccggtctatccggcggcttcatcgcatcttggatctgaaaga
gggttgagtgtccgattccctcgtttcatacgcatgcgagacgacaagacatgggaggac
gctatgacaagtgatcagcttgccgatatgtacagacgccagataaaagaaggcgagaag
acaaccaaaaactag

DBGET integrated database retrieval system