KEGG   Cryptococcus neoformans var. neoformans JEC21: CNB01250Help
Entry
CNB01250          CDS       T00243                                 

Definition
(RefSeq) short-chain dehydrogenase, putative
  KO
K16066  3-hydroxy acid dehydrogenase / malonic semialdehyde reductase [EC:1.1.1.381 1.1.1.-]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00240  Pyrimidine metabolism
cne00260  Glycine, serine and threonine metabolism
cne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CNB01250
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CNB01250
Enzymes [BR:cne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.381  3-hydroxy acid dehydrogenase
     CNB01250
    1.1.1.-  
     CNB01250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR 2-Hacid_dh_C Pyr_redox_2 Epimerase THF_DHG_CYH_C 3HCDH_N Eno-Rase_NADH_b Methyltransf_2 Helicase_RecD DUF1776 GDP_Man_Dehyd
Motif
Other DBs
NCBI-GeneID: 3255851
NCBI-ProteinID: XP_024512120
LinkDB All DBs
Position
2:join(381930..382036,382097..382113,382172..382421,382481..382527,382590..382595,382661..382696,382751..383047,383103..383177,383229..383281)
Genome map
AA seq 295 aa AA seqDB search
MFSILTKTTTNLLLLQTRRKVVLQQIRTMSVFSTSRLAGKTVLVTGASAGIGASTAELFA
KCGSNVVLLARRADNLQAVKAKCEAAHKESGLKEGGKVVVIEADMQKNEHLDAIPTKLEG
LEVDILVNNAGMVRGKEQVGDISEDDINVMFSTNVLGLIHLTQIFVRQFKQRNAGMIINL
GSIAGREPYAGGAIYCATKHALAAFTGSLLRELVNTPIRVCEVQPGMVETEFSIVRFRGD
KDAADAVYKGIQPLVAQDIAEEIVWCASRPAHVNIAQLFVMPVNQATPTLAHRSS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtttagtatcttgacaaaaactacaacaaatttattactactccaaaccagaagaaaa
gtagtcctacaacagatcagaaccatgtctgtattcagcacctctcgattggctggtaaa
actgtccttgtgactggtgcctccgccggtatcggtgcctcaactgccgagctcttcgct
aaatgcgggtccaatgtcgtcctcctcgcccgacgagcggacaaccttcaagcagtgaaa
gctaaatgtgaagctgcccacaaggagtctgggctaaaggagggcggtaaagtggtcgtc
attgaggcagacatgcagaagaatgagcacttggatgccatccccaccaagcttgaaggc
ttggaagttgacattcttgtcaacaatgctggtatggtgaggggtaaagagcaagtggga
gacatctctgaagatgacatcaatgtgatgttctcaaccaacgtcctcggtctcattcac
ttaactcagatctttgttcgtcaattcaagcaacgaaacgctggcatgattattaacctc
ggttccatcgccggtcgtgaaccttacgctggtggtgccatctactgcgctaccaagcac
gcccttgccgctttcaccggcagtttgttgagagaacttgtcaacacccccatcagagtc
tgtgaggttcaaccgggcatggtggagacagagttctccattgtcaggttcaggggcgac
aaggacgctgccgatgctgtttacaaggggattcagccattggttgctcaggatatcgcc
gaagaaatcgtttggtgtgcctccaggcctgcgcatgtcaatattgcccaactcttcgtc
atgcctgtcaaccaggccacgcctactcttgctcaccgaagttcttaa

DBGET integrated database retrieval system