KEGG   Cryptococcus neoformans var. neoformans JEC21: CNB01730Help
Entry
CNB01730          CDS       T00243                                 

Definition
(RefSeq) oxoglutarate dehydrogenase (succinyl-transferring), putative
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00020  Citrate cycle (TCA cycle)
cne00310  Lysine degradation
cne00380  Tryptophan metabolism
cne01100  Metabolic pathways
cne01110  Biosynthesis of secondary metabolites
cne01130  Biosynthesis of antibiotics
cne01200  Carbon metabolism
Module
cne_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cne_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CNB01730
  09105 Amino acid metabolism
   00310 Lysine degradation
    CNB01730
   00380 Tryptophan metabolism
    CNB01730
Enzymes [BR:cne01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CNB01730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 3255601
NCBI-ProteinID: XP_568841
UniProt: Q5KMH0
LinkDB All DBs
Position
2:complement(join(510165..510365,510432..510749,510806..511103,511168..512773,512821..513073,513124..513325,513393..513577))
Genome map
AA seq 1020 aa AA seqDB search
MLRSIPKHIRIPSRSTAQPARAILSLSAVQRHTQKRSYAAEAVAPSKNDAFANGGNAYYT
EEMYRLWKQDPKSVHVSWQTYFSGLDKGLPSAHAFTPPPGVLSGAVPTPAGGSPKLSVEG
SGDVTDYLKVQLLIRAYQVRGHHIANLDPLRISGADLDGRVPPELKLDYYGWTEADMTKE
FRLGDGILPRFMGQVKDDTMTLGQIIDELKQMYCTHVGCQYVHIPDRGQCDWIRERVEIP
TQWNYSTEEKRMILDRLMWSELFEKFIASKYPNEKRFGLEGCESLIPGMKALIDRSVDAG
VKSIVLGMPHRGRLNVLGNVIRKPIEAILNEFKGNEDADDTGGGDVKYHLGANYIRPTPS
GKKVSLSLVANPSHLEAEDPVVLGKTRAIQHFEGDEGDGSSAMGVLLHGDAAFAGQGVVY
ETMGMQNLPNYGTGGTVHLIVNNQIGFTTDPRFARSTPYPSDIAKSIDAPIFHVNSDDVE
AVNYVCTLAADWRATFKKDVVIDIVCYRRYGHNETDQPSFTQPKMYKAIQKQPTVLSIYT
DKLIKEGTFTEKEIDEHRQWVWGMLEKAYDGSRDYKPSPREWLSSSWEGFPSPKELAEEV
LPQHHTGASEDALKRVGQIISSFPEGFHPHKNLARIIGNRGKTVAEGKNIDWSTAEALAF
GTLCLEGTHVRISGQDVERGTFSQRHAVVHDQKTEQTHIALKHLDADQGSFTVTNSHLSE
FGTLGFELGYSLVSPNSLTIWEAQFGDFANNAQCIIDQFIAAGERKWLQRTGLVLSLPHG
YDGQGPEHSSGRIERFLQLCDDEPRVYPSPEKLERQHQDCNMQVVYPTTPANYFHVLRRQ
NKRDFRKPLIVFFSKSLLRHPLARSSLEEMSGDSKFQRYIPEPHPESLVEPEKIRRHILC
TGQVYFQLLKEREERGINDVAISRIEQLSPLPYDRLTPHLDKYPNADLVWAQEEPLNNGA
WTYVQPRLITALQETEHHKSKIPFYAGRKPSSSVATGSKYAHKKEIEMINEMAFAPSEGQ
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggtcaattccaaaacatatccgtataccgtctcgatcaacggctcagcccgct
agggccatactctccctctctgctgtccagcgacatactcaaaaacgaagctatgctgca
gaggccgtcgctcccagtaagaatgatgccttcgccaacggcggaaatgcgtactacact
gaggagatgtaccgcctctggaaacaagaccccaagtctgtccatgtatcctggcaaact
tacttctctggcctcgacaagggtcttccttctgctcacgctttcactcctccccccggt
gttctctctggtgccgttcctacccctgccggcggaagccccaaactttctgttgagggc
agtggtgatgtcactgattatcttaaagttcaacttttgatccgtgcctaccaagttcga
ggtcatcacattgccaacctcgatcctcttcgcatttctggtgccgatctcgacggtcgt
gtccctcctgagcttaaactcgactactatggttggactgaagccgacatgacgaaggaa
ttcaggcttggcgacggcattctcccccgattcatgggtcaggtcaaggacgacacgatg
actctgggtcagatcattgatgagctcaagcagatgtactgtacccacgttggctgccag
tacgttcacatccccgaccggggacaatgcgactggatccgggagcgcgtcgaaattcct
acccaatggaactactccaccgaggaaaagaggatgattcttgaccgactcatgtggtct
gagctttttgaaaagttcattgcctccaaataccccaacgagaagcgtttcggtcttgag
ggttgcgagtctttgatccctggtatgaaggcgctcattgatcgttccgtggatgctggt
gtcaaatctatcgttcttggtatgccccaccgtggtcgtcttaacgtccttggtaacgtc
atccgaaaacctattgaggccatcttaaacgagttcaagggtaacgaggatgccgacgat
actggcggtggtgatgtcaaataccacctcggtgccaactacatccgtcctactcccagc
ggcaagaaggtttccttgtcccttgttgccaacccttcgcacttggaggctgaagaccca
gttgtcctcggtaagaccagggctatccagcactttgaaggtgacgagggagacggatcc
tctgccatgggcgttttgctccacggtgacgctgcctttgctggtcaaggtgttgtttac
gagaccatgggtatgcaaaaccttcccaactacggcactggtggtaccgtccacttgatt
gtcaacaaccaaattggtttcaccaccgacccccgatttgcccgttctaccccttacccc
tctgatattgccaagtctatcgacgcccccatcttccacgtaaacagtgacgatgtcgag
gccgtcaactacgtctgtaccctcgctgctgactggcgagctaccttcaagaaggatgta
gttatcgatattgtctgttaccgacgatacggtcacaacgagactgaccaacccagcttc
actcagccaaagatgtacaaggctattcaaaagcaacctaccgtcttgtctatctacacc
gacaagttgatcaaggaaggtacttttactgaaaaggagattgacgagcacaggcaatgg
gtttggggcatgcttgagaaggcttacgacggatccagggactacaagccttctccccga
gaatggctttcctcctcttgggaaggtttcccttctcccaaggagcttgccgaagaggtt
ctccctcagcaccataccggtgccagcgaggacgccctcaagcgtgttggtcagatcatc
tctagtttccccgaaggtttccacccccacaagaaccttgcgcgaattattggcaaccga
ggcaagactgtagccgaaggcaagaacattgactggtctactgctgaagctcttgctttc
ggtactttgtgccttgagggtactcacgttcgaatctccggtcaggatgttgagcgtggt
actttttctcagcgacacgctgtcgtccacgaccaaaagactgaacagactcacatcgct
ctcaagcacctggatgctgaccagggctctttcactgtcaccaactctcacttgtcagag
tttggtactctcggtttcgagctcggttactctcttgtctcccccaacagtttgactatc
tgggaggctcagttcggtgactttgccaacaatgcccaatgtatcattgaccaattcatt
gctgcgggtgagcgaaaatggctccagcgaactggtctggttctctccttgcctcacggt
tacgacggtcaaggtcccgagcactcttctggtcgtatcgagcgattcctccagctctgt
gacgatgagccccgagtgtacccctcgcctgaaaagttggagaggcagcaccaggactgc
aacatgcaggtcgtctacccgactactcctgccaactatttccacgttctcaggcgacaa
aacaagcgtgacttccgaaagcccttgattgtcttcttctccaaatcccttctccgacat
cctcttgcccgatcttctctcgaggagatgtctggtgactccaagttccagcgatatatt
cccgaaccccatcctgaatcccttgtcgagcctgagaagatccgacgacacattttatgt
actggccaggtctacttccagctcctcaaggagcgtgaagagcgaggtatcaacgacgtt
gccatttccaggattgagcaattgtctcccttgccttatgaccgtttgactcctcatctt
gacaagtaccccaacgctgatcttgtctgggcccaggaggagcctctcaacaatggtgcc
tggacctacgttcagcctcgactcatcaccgccctccaggagactgagcatcacaagtcc
aagatcccattctacgctggtaggaaacctagcagttccgttgctaccggttccaagtat
gcgcacaagaaggagattgagatgatcaacgagatggcttttgctccttccgaaggacag
tag

DBGET integrated database retrieval system