KEGG   Cryptococcus neoformans var. neoformans JEC21: CNB04090Help
Entry
CNB04090          CDS       T00243                                 

Definition
(RefSeq) isocitrate dehydrogenase (NADP+), putative
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00020  Citrate cycle (TCA cycle)
cne00480  Glutathione metabolism
cne01100  Metabolic pathways
cne01110  Biosynthesis of secondary metabolites
cne01130  Biosynthesis of antibiotics
cne01200  Carbon metabolism
cne01210  2-Oxocarboxylic acid metabolism
cne01230  Biosynthesis of amino acids
cne04146  Peroxisome
Module
cne_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cne_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CNB04090
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CNB04090
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CNB04090
Enzymes [BR:cne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CNB04090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 3255582
NCBI-ProteinID: XP_569233
UniProt: Q5KLU0
LinkDB All DBs
Position
2:join(1202539..1202541,1202767..1202958,1203015..1203080,1203147..1203287,1203354..1203694,1203749..1203941,1204010..1204423)
Genome map
AA seq 449 aa AA seqDB search
MLARSTTAFTRSSLLRSTRPLAFAMASRNYASTPAGIDRIKVKNPVVEIDGDEMTRIIWK
KIREELILPYVDVDLKYYDLGMESRDATNDQITIDSAEAIKKYSVGVKCATITPDEARVK
EFKLKEMWRSPNGTIRNILGGTVFREPIILDKIPKPVPGWTKPICIGRHAFGDQYRSTDF
IAPGPGKLTLTYTPAEGGAPTELNVYDFKGKGVALAMYNTDESIYGFAHASFKMALSKKM
PLFMSTKNTILKKYDGRFKDIFQEVYESTYKAEFEKLGVYYEHRLIDDMVAQAIKSSGGF
VWACKNYDGDVMSDILAQGFGSLGMMTSELITPDGKTMESEAAHGTVTRHYRQYQAGHET
STNPVASIFAWTRGLAFRAKLDETPALEAFAKDLEAACVEVIDKDGIMTKDLALAMKGKD
MTRDDWVTTDVYMKKVNERLVEKLKARSA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctcgaagcaccactgcctttacgcgctcatctcttctccgatcaactagacct
ttagcattcgcaatggcttcacgcaactatgcttccacccctgccggcatcgacaggatc
aaggtcaagaaccccgtggttgagattgacggtgatgagatgacaaggatcatctggaag
aagatcagggaggagcttatcttgccctacgttgacgttgacctcaagtactacgacttg
ggaatggagagccgagatgctaccaacgaccaaatcactatcgactctgccgaagctatc
aaaaagtactctgtcggtgtcaagtgcgctaccatcacccctgacgaggctcgagtcaag
gaattcaaattgaaggaaatgtggcgaagccccaacggaactatccgaaacatcctcgga
ggaaccgtcttccgagagcccatcattctcgacaagatccccaagcccgtccccggatgg
accaagcccatctgtatcggtcgacatgctttcggtgaccaataccgatccaccgacttt
atcgcccccggacccggaaagctcaccctcacttacacccccgctgaaggaggtgccccc
accgagctcaacgtctacgacttcaagggcaagggtgtcgccttggccatgtataacacc
gacgaaagcatttacggtttcgcccacgcgagcttcaagatggctttaagcaagaagatg
cccttgttcatgtctaccaagaacaccatcttgaagaagtacgatggccgattcaaggac
attttccaagaggtctacgaatctacgtacaaggccgagtttgagaagctcggtgtctat
tatgagcatcgcctcatcgacgacatggttgctcaggccatcaagtcttctggtggtttc
gtttgggcgtgcaagaactacgacggtgatgtcatgagcgacattctcgcccagggtttc
ggttctctcggtatgatgacttccgagctcatcaccccagacggcaagaccatggaatct
gaagctgcccacggtaccgtcacccgacactaccgacaataccaagccggtcacgaaacc
tctaccaaccctgttgcctccatctttgcctggacccgagggcttgccttccgagccaag
ttggacgagacccccgcgctcgaggcgttcgccaaggacttggaagctgcctgtgttgaa
gtcatcgacaaggacggtatcatgaccaaggatttggctttggcgatgaagggtaaggac
atgactagggatgactgggtcaccaccgacgtctacatgaagaaggtcaacgagaggttg
gtcgaaaagctcaaggcgaggagcgcgtaa

DBGET integrated database retrieval system