KEGG   Cryptococcus neoformans var. neoformans JEC21: CNE04360Help
Entry
CNE04360          CDS       T00243                                 

Definition
(RefSeq) fatty-acid synthase complex protein, putative
  KO
K00667  fatty acid synthase subunit alpha, fungi type [EC:2.3.1.86]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00061  Fatty acid biosynthesis
cne01100  Metabolic pathways
cne01212  Fatty acid metabolism
Module
cne_M00082  Fatty acid biosynthesis, initiation
cne_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CNE04360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cne01004]
    CNE04360
Enzymes [BR:cne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.86  fatty-acyl-CoA synthase system
     CNE04360
Lipid biosynthesis proteins [BR:cne01004]
 Fatty acid synthase
  Yeast type
   CNE04360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAS_I_H ketoacyl-synt Ketoacyl-synt_C ACPS Thiolase_N KR
Motif
Other DBs
NCBI-GeneID: 3257758
NCBI-ProteinID: XP_571099
UniProt: Q5KG99
LinkDB All DBs
Position
5:complement(join(1215651..1215984,1216035..1217480,1217546..1218056,1218130..1219455,1219508..1219810,1219865..1219927,1219978..1220121,1220175..1220266,1220321..1220349,1220410..1220478))
Genome map
AA seq 1438 aa AA seqDB search
MAAEGMDKESIVRRELTSRCIAIMNRADPALLDYMKYHIDNADPSKGPTFQKIKEFGQIL
LDNCKEVVDKPPVYRDVALPTAPHTEISAKGDIVYSEVSRQNVRKLESYVKEMASGGEVE
PAVNLEKVQSDIEKLWDLVNSQPSITAAQKSAIKSMYSEVVKSLGQSSGSALEDAESPAI
ARAKGPKQRRSSSQFLRPNVEDRTEVEEAHLPFLHLKRKTGTSFSYSAKLTNIYFDVLTE
IATSGVTFAKKAALLTGVGKGSIGVEILKGLLSGGCTCIVTTSRYSRAAVDYYKNIFHEI
GSKGSKLIVVPFNGASRQDVEALVDYIYSTLQIDLDYIIPFAALPENGREIDSIDDKSEL
AHRLMLTNLLRLLGAVKQKKAARQFVTRPTQVVLPLSPNHGIFGNDGLYSESKISLETLF
NRWSAESWGEYLCIAGAVIGWTRGTGLMSATNFVAEGLEKLGVRTFSAKEMAFNILGLMH
PLLFDITQIEPIWADLNGGMDRVAGLAEVMTSIRVDINRVAELRKAITIDNAADFRVING
GDAERLHQKVAITPRANFSFDFPKIDSDDILNELKHLQGLIDLDKVIVCTGFAEVGPWGS
SRTRWEMEARGEFSIEGCIEMAWMMGFIKHLDGKLGNGQTYVGWVDAKSGEPVDDKDVKT
KYEKDIIKHAGIRLIEPDLFWGYNPEKKGFIQEIELNHDLEPLEVAAEEAARFKREHGDK
VDIWAQESGEWFVKFNKGARIFLPKAVKFDRVVAGQLPTGWDARRFGLPDDIIAQTDRTA
LWALVCTMEALIMSGVTDPYELYKYIHPSEVGTSLGSGMGGMHSMSAMFKDRREERDVQK
DVLQETFINTVAGWVNLLLLSSSGPVKIPVGACATALQSVEIACDTILTGKAKVMIAGGF
DDFSEEGSFEFANMKATSNAETEFAMGREPNEFSRPMTSTRSGFMESQGCGVHVMMSAKT
AIEMGASIQGIVAYTSTHTDKAGRSIPAPGRGILSTAREVTPKEALPLLDIKYRSRQLAF
RRKQISQWLENEHELLRMELETRKGGDNEEWFQNRVAFIDDEARRQEKDALATFGMLEGS
HPNIAPLRRALAVWGLNADSVGAISCHGTSTKANDKNESGVYNLQFEQLGRTPGNAVPVI
AQKSLTGHPKGGAAAWMFNGMCQTINSALVPGNHNADNISEELRAFRHLFYPSKPIQHVR
LECGLLTSFGFGQVGGQVAIVHPRYLFAALQTHELEAYKKRRQDRELNTYSRMSSALVNN
NMVQIKDGPPYTAELEGSVLLNPLARAGPSKNSFAFQGKLPTKVPLDIKNAETLKAMFDQ
AGALSGVGVDTELISNVPTSETFRERNFTADEISYCNSAADPTASFAGRWAAKEAVFKAL
SVPSKGAGAPLKEIEIVSTSSGPTVKLSGDALAAAGGKSVKVSLSHSDTSVVAFAVAQ
NT seq 4317 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgaagggatggacaaagagagcatcgtcaggcgtgagctcacgtcgagatgt
atcgccatcatgaaccgtgccgatcccgcccttcttgactatatgaagtaccacatcgac
aatgccgatccttccaagggccctactttccaaaagatcaaggagtttggacaaatcttg
cttgacaactgtaaggaggttgtcgacaagccccctgtttacagggacgttgcgctcccc
actgcgccccacaccgagatttccgccaagggtgacattgtctactctgaagtctctagg
caaaacgttagaaagctcgagagttatgttaaggaaatggcctctggtggtgaagtcgag
cccgctgtcaacctcgaaaaggtccagtccgatattgaaaagctctgggacctcgtcaac
tctcaaccttccatcaccgctgcccaaaagtcggccatcaagtccatgtacagtgaagtt
gtcaagtctctaggccaatcgtccggctctgctctcgaagacgccgaatcccctgctatc
gcccgtgccaagggccccaagcagcgacgatctagttcccagttcttgaggcccaacgtc
gaagacaggaccgaggtcgaggaggctcacttgcccttcttgcaccttaagaggaagact
ggtaccagcttttcctacagtgccaagcttaccaacatctactttgatgtccttactgag
atcgccacctctggtgtcacttttgccaaaaaggccgcccttctcaccggtgtcggcaag
ggttccatcggtgtcgaaatcctcaagggtcttctctctggtggttgtacctgtatcgtg
accacctctcgatactctcgagctgccgtcgactactacaagaacattttccatgagatt
ggttccaagggctccaagcttattgtcgttcccttcaacggtgcttctcgtcaggatgtc
gaggctcttgtcgactacatctactccaccctccagatcgacttggactacattatcccc
ttcgccgctcttcccgagaacggccgtgaaatcgactctattgacgacaagtctgagctc
gcccaccgactcatgcttaccaacctcctccgtctcctcggtgccgtcaagcagaaaaag
gccgctcgtcaattcgtcacccgacccacccaggtcgtcctccctctttctcccaaccac
ggtatctttggtaacgacggtctctattccgagtccaagatttccctcgagaccttgttc
aacaggtggtccgctgaaagctggggagagtacctctgtatcgccggtgccgtcatcggt
tggactcgaggtaccggtctcatgagcgctaccaactttgttgccgagggtctcgaaaag
ctcggtgtcaggactttctccgccaaagaaatggccttcaacattcttggtctcatgcac
cctctcttgttcgacattacccagatcgaacccatctgggccgacctgaacggtggtatg
gaccgtgtcgccggtttggccgaggtcatgacttccatccgagtcgacatcaaccgagtt
gccgaattgcgaaaggccatcaccatcgacaacgccgccgacttccgtgtcatcaacggc
ggtgatgccgaaaggcttcatcaaaaggtcgccatcactccccgagccaacttttcgttc
gacttccccaagatcgacagtgacgacattctcaacgaactcaagcatcttcagggcttg
atcgaccttgacaaggttatcgtctgtaccggttttgctgaagtcggtccttggggttct
tcaaggacccgatgggagatggaggcccgtggcgagttttccattgagggctgtatcgag
atggcctggatgatgggcttcatcaagcaccttgacggtaaactcggtaacggccagacc
tacgtcggatgggttgacgccaagtctggtgagcctgtcgatgacaaggacgtcaagacc
aagtacgaaaaggacattatcaagcacgccggtattcgtcttatcgaacccgacttgttc
tggggttacaaccctgagaagaagggcttcattcaggagattgagctcaaccacgatctc
gaaccgcttgaagtcgccgctgaagaggccgctcgattcaagcgcgagcacggcgacaag
gtcgacatctgggcccaggaatccggcgagtggttcgtcaagttcaacaagggtgccagg
atcttcctccccaaggccgtcaagtttgaccgagtcgtcgctggccagcttcctaccggt
tgggacgctcgtcgattcggtttgcccgatgatattatcgcccagactgacaggacggcc
ctttgggctttggtctgcactatggaggctttgatcatgtccggtgtcaccgacccttac
gagttgtacaagtacatccaccccagcgaggttggtacttctttgggttccggtatgggt
ggtatgcattctatgagtgcgatgttcaaggataggcgagaggagagagatgttcagaag
gatgttttgcaggaaactttcatcaacaccgtcgccggttgggtcaaccttcttttgctt
tcttccagtggtcccgtcaagatccccgtcggtgcgtgcgctaccgccctccaatccgtc
gagatcgcttgcgataccatccttaccggcaaggccaaggtcatgattgccggtggtttc
gacgacttttctgaagaaggctctttcgaattcgccaatatgaaggccacctctaacgcc
gaaaccgagtttgccatgggccgtgaacccaacgagttctctcgacctatgacttctacc
cgttccggcttcatggagtctcagggttgtggtgtgcacgtcatgatgtctgcaaagacc
gccatcgagatgggtgcctcaatccagggtattgtcgcctacacctccacccacactgac
aaggctggtcgatccatccctgctcccggtcgaggtatcctctctactgcccgtgaagtc
acccccaaggaggctttgcccttactcgacatcaaataccggtctcgacaactcgcgttc
cgacgcaagcagatctctcaatggcttgagaacgagcacgagctcctccgtatggagctc
gagacccgaaagggtggcgacaacgaggagtggttccagaaccgagtggcgttcatcgat
gacgaggcgaggaggcaggagaaagatgctcttgctacctttggtatgctcgagggttcc
caccccaacattgctcccttgcgtcgcgccctcgccgtttggggtcttaatgccgacagc
gtcggtgccatctcttgccacggtaccagtaccaaggcaaacgacaagaacgagtctggt
gtctacaaccttcagttcgaacagcttggtcgaactcctggtaatgccgtccccgttatt
gcgcagaagagcttgactggtcaccccaagggtggtgccgccgcgtggatgttcaacggc
atgtgccagaccattaacagtgctcttgtccccggtaaccacaatgccgacaacatctct
gaagagctccgtgctttccgccacctcttctacccctctaaacccatccagcacgttcga
ctcgagtgtggtcttctcacctctttcggtttcggtcaggtcggtggtcaggtcgccatt
gttcatcctcgatacttgttcgccgctctccaaacccatgagcttgaggcttacaagaag
cgacgacaggaccgtgagctcaacacctactctcgaatgtcctctgcccttgtcaacaac
aacatggtgcagatcaaggacggacctccttacactgctgagcttgagggcagtgtcttg
ttgaatcctctcgccagggctggacctagcaagaattcttttgccttccagggcaagttg
cccaccaaggttccccttgatattaagaacgcggagactttgaaggccatgttcgaccag
gctggtgctctctctggtgtcggtgttgacaccgagctcatctctaatgtccctacctcc
gaaacattccgtgaacgcaacttcactgccgatgaaatctcctactgtaactctgctgcc
gaccccactgcctcctttgccggtcgatgggctgccaaggaagccgtgttcaaggctctc
tctgtcccttccaagggcgctggtgctcccttgaaggagattgagattgtctctacttct
tctggaccgactgtcaagttgagcggggatgcgcttgctgcagcgggaggtaagagcgtg
aaggtttcattgagtcactctgacacctcagtcgtggctttcgccgtggctcaatga

DBGET integrated database retrieval system