KEGG   Cryptococcus neoformans var. neoformans JEC21: CNF00610Help
Entry
CNF00610          CDS       T00243                                 

Definition
(RefSeq) alpha-glucosidase, putative
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00052  Galactose metabolism
cne00500  Starch and sucrose metabolism
cne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CNF00610
   00500 Starch and sucrose metabolism
    CNF00610
Enzymes [BR:cne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CNF00610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 3258280
NCBI-ProteinID: XP_024512997
LinkDB All DBs
Position
6:join(203685..203703,203769..203951,204008..204214,204274..204679,204741..204936,205006..205199,205254..205740)
Genome map
AA seq 563 aa AA seqDB search
MVCVISDPDWWRQAVVYQIYPRSFADANGDGIGDLKGITARVPYLKALGVDAIWLSPFYP
SALRDGGYDVADYRDVDPKIGTLEEFDEMTAAFQKVGIRVIVDIVPNHSSDDHEWFQAAL
KAGKGSPERERYIFRDGLGPNKDQPPTDWICSFGGSAWSPSGMNDGQWYFHWFDSSQPDW
NWENPDVKADFLKTLKFWGDRGVSGFRIDVAHGLAKDMSEPLPNWEQLTKLTHQKLTNGN
SELDHPLLDRKEVHDIYRSWREVFNQFNPPLMAVAEAWVAPDQKPLYASSEGLGQTFSFD
ILLCNFDAEEYRQCIKSSLAGSKKSDSTTTWVLSNHDVMRHPTRFGLPNVPNANHAMTTD
TYNKFLKTKLTDPKVDIEQGLRRAKAATLMILALPGSTYLYQGEELGLQEVVEIPDEERQ
DPIFIRTKGEEVGRDGCRVPIPWVADEKNFGYGPGKRAHLPQPAWFKDYAVDVEEKDANS
VLSLYRRALGLRKGLQSAEELEWVENPNKEVLHFRRPGGWEVVVNIGKDSVDLPKGSVLI
SSSNNALKGGSIPGETTVWLKSA
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggtctgtgttatttccgaccccgactggtggcgccaggccgtcgtctatcaaatctat
ccccgttccttcgccgacgcgaacggtgatgggattggagacttaaaaggtataactgct
cgtgtgccgtatttgaaagcattaggagtggatgccatttggctcagccctttctatcct
tccgctttgcgggatggcggttatgatgtggccgactacagggatgtcgacccgaagatc
gggacattggaagagtttgacgaaatgaccgctgctttccaaaaagtcggaatccgagtc
atcgtcgatatcgtccccaaccattcaagcgatgaccatgaatggttccaagctgctttg
aaagcgggtaaggggtcaccagagagggaaaggtacattttcagagatggtctcggaccc
aacaaagatcagcctcctaccgactggatctgttctttcggtggatctgcttggtcgcct
tctggaatgaacgacggtcaatggtatttccactggtttgactcctctcaaccggactgg
aattgggagaacccagatgtcaaagcagatttcctgaagaccttgaagttttggggtgat
cggggagtctcaggtttccggattgacgtcgcccacggccttgctaaagacatgagcgag
cccttgcctaactgggagcagttgactaaattgactcatcaaaagctcactaacggtaac
tccgagttggatcatccccttctcgacaggaaggaggtacacgatatctacagatcttgg
agagaagtcttcaaccagttcaatcccccactcatggctgttgctgaagcctgggttgct
ccagaccaaaagcccctctacgcttcttctgagggtctcggccagaccttctctttcgat
attcttttgtgcaactttgatgctgaggagtaccgtcaatgcattaagagttcattggca
ggaagcaaaaagtccgactcaactactacctgggtactgtccaatcatgatgtaatgcga
catcccacccgattcggtctccccaacgtcccgaatgcgaaccatgcaatgactacggac
acctataacaagttccttaaaaccaagttgacggatcccaaggttgatattgagcaaggg
ttgaggagagccaaagcggctactctcatgattcttgccttgccgggatccacataccta
tatcagggtgaagaacttggcttgcaagaagtcgtcgaaattccagacgaggaacgacaa
gaccctatattcatccgaacaaagggagaagaagtcggtcgtgatggctgtcgagttcct
attccttgggttgccgatgaaaagaactttggctacggtcctggcaaacgtgcgcatctc
cctcagcctgcgtggttcaaagactatgcggtcgatgtagaggaaaaggatgccaacagc
gtattaagcctttaccgacgggctttaggattgagaaaagggctgcaatctgcagaggag
cttgaatgggtggagaatcctaacaaagaagtcctgcatttccgaaggcccggtggatgg
gaggtagttgtcaacatcggcaaagattctgttgatctgcccaagggttccgttcttatt
agttcatctaataacgcgctcaagggtggaagcattcctggggagacgactgtttggctc
aagtctgcgtag

DBGET integrated database retrieval system