KEGG   Cryptococcus neoformans var. neoformans JEC21: CNF00820Help
Entry
CNF00820          CDS       T00243                                 

Definition
(RefSeq) expressed protein
  KO
K20813  thymine-DNA glycosylase [EC:3.2.2.29]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cne00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CNF00820
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cne03400]
    CNF00820
Enzymes [BR:cne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.29  thymine-DNA glycosylase
     CNF00820
DNA repair and recombination proteins [BR:cne03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     CNF00820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-GeneID: 3258426
NCBI-ProteinID: XP_024513000
LinkDB All DBs
Position
6:join(269568..269618,269701..269719,269783..269850,269911..269940,270024..270569,270629..270790)
Genome map
AA seq 291 aa AA seqDB search
MSSTLGHHFAHPTNKFWKALYQSGLTSRLMSPTEDYKVVDEYNYGLTNLVGRPTSEQSEL
STLEMKLNTINLLQKFIKYQPSVVCFVGKKIWDVFESVVGKTAEFDETVKQKVKLEGEVE
NGEGSGDGGKGRSVMTLAPTPERGTVKIEPAELGDQPSLLPLSASPSKTPQLTPAQTASL
SPAKARAKKGAIKPPKTPFSFSQPRALRIPHPPEDNGGEIKYTYFFVVPSTSGLERTPFP
EQVANFAALKALVDELKKGRSLQGDFLNISVEGVEGTVEDMRRAAILKNAL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctactttgggccatcatttcgcccatccaaccaacaagttttggaaagctctt
tatcagtcggggcttacttcaagattgatgtcgccaactgaagactataaagtcgttgac
gagtataactatggtctcaccaatcttgtgggcagaccgacttccgagcaaagtgaatta
tctaccctggaaatgaagctgaacactatcaacttgttacaaaagttcataaaataccag
cccagtgtcgtctgttttgtggggaagaagatctgggatgtatttgagagtgtagttggg
aagacggccgagtttgacgagactgtgaaacaaaaggtcaagctggagggtgaagttgaa
aatggagaaggcagcggtgacgggggaaaaggaaggagcgtgatgacactcgctccgaca
ccggaaagaggaacggtcaagatcgagccggccgaactgggtgatcagccgtccctactt
ccactctcggccagtccatcgaaaaccccgcaacttacaccggcccaaactgcttcactc
tctccagccaaagctagagcgaaaaaaggagctatcaagcctccaaaaacaccctttagc
ttctcccaacctcgtgcactgagaattccgcatcctcctgaagacaatggaggtgaaatc
aagtatacgtatttctttgtggtaccgagtacttcggggctggaaaggacaccttttccg
gaacaagtggccaattttgcagccctcaaggcattggtggatgagctgaaaaagggtaga
tccctgcagggcgattttctgaatatcagcgtggaaggtgtagaggggactgtggaagat
atgcggcgggcagctatcttaaaaaatgctctatga

DBGET integrated database retrieval system