KEGG   Cryptococcus neoformans var. neoformans JEC21: CNG01340
Entry
CNG01340          CDS       T00243                                 

Definition
(RefSeq) microtubule motor, putative
  KO
K10398  kinesin family member 11
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Brite
KEGG Orthology (KO) [BR:cne00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cne03036]
    CNG01340
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cne04812]
    CNG01340
Chromosome and associated proteins [BR:cne03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    CNG01340
Cytoskeleton proteins [BR:cne04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     CNG01340
SSDB
Motif
Pfam: Kinesin Microtub_bd Microtub_bind CorA SLIDE Apolipoprotein
Other DBs
NCBI-GeneID: 3258851
NCBI-ProteinID: XP_024513189
LinkDB
Position
7:complement(join(387773..388420,388480..388631,388678..389679,389731..390611,390660..391025,391073..391378,391431..391714))
AA seq 1212 aa
MSRRPTTNRSGMSRTAPSTSISMPPPSRIPNRPPSVMSVSQASHGRNDGDSRAASPQRKI
RKTVNGSITNRKMETPGVGINTDGEINIQVVVRCRGRSQQEVDQASPVITTTTGPISKMV
TVETTPLPSATLSTFATASYGGTHQPATKTYPFDKVFGPEADQTMVFNEVAEGMLGEVLS
GYNCTIFAYGQTGTGKTYTMQGDLELTNLDAPKSTAGIVPRVLHRLFSILESQADTEYSI
KCSYVELYNEELRDLLAPEYRGEQSGTGGLKLYEDGKKGTMIQGLEETGVRNLKEALGML
DKGVRRRQTAETKMNTESSRSHTIFSITVHVKESGVQRGGEDMLRIGKFNLVDLAGSEAI
GRSGATDKRAREAGMINQSLLTLGRVISALVEKGSHIPYRESKLTRLLQDSLGGRTKTCI
VATISPTRSNMEETLSTLDYAIRAKSIRNRPEVNAHLTKAGLLKEYVGDIERLKAELAAT
REKNGIYIPEDQWREMHENQVKQKSDYDEAKLKASVIEVALDTKKKEFDEVSVRLLATVD
ELAQVREAEKQLTEMLDETKIVLDTIKTRLDEETVISQAYMQGEERLDAVAGGLKKVATE
SVNDVGGLFEKIARKAKVLGSNASAATQFGGELQGLSQGLRNGLSQLQSAHDNFGQEIQI
EMEAYALKEQQATKHDLAALDRSFVAFNDLSQKLAASNEKGQREASDLSKSLLTVKDEVQ
NSVREWAQGVSERSKSMVDELLGHQQQHLTAVGSVLDSTASLVDAIITTAQKHLAAESAS
ALRARDLAIQTSSSEITRLRSQNLLLAKLLSEEKAKTAKLRTELIGNLTSMIESFTDEQD
KGLSAVVDKVKMENEKSVEEMEEFGEEARSVWEEGDGRRKLFEDEVRSGGERAVLQKGEG
QLALGQVREGLRERLESYGQETMEEAEAHVEVVDGFCVKMAKSATSVANKSTARGKKNSE
IIEALARNVKSTHEASQARSSAMADSIDSLTSTLLTSQSSSSATFSQAYSATESNLNSIM
SSTADFLKSGIQEDIPTGITPRKKVWNVQAEWERTGPREAVLASWRKRQESAEQSESENG
VRDESQVTTNRRILRLRRTDSRKLPGVVNDEASEAADEVLEDGVSQTESQASISSTIMSR
TSSREPTPTGIPPPPSIPSTRTSSGQTIPTRSKLTRSTTGKKLGNEIADEPRPAVTVLGE
GGVNLPRRGERR
NT seq 3639 nt   +upstreamnt  +downstreamnt
atgtctaggaggcctaccaccaacaggtcagggatgtcaagaacagcgccgtcaacgtct
atctcaatgcctccaccatcaaggatccccaatcggccgccatcggtcatgtcggtatct
caagcttcacatgggagaaatgatggagatagtcgagctgcgagcccacaaagaaagata
agaaagactgttaacggatctataacaaatagaaaaatggaaacgcctggggtgggaata
aatacagatggtgaaatcaatattcaagtggtcgtgcgatgtcgtggacgctcgcaacaa
gaggtggatcaagcatctccagtcattaccaccaccactggaccgatatcaaagatggtc
accgtcgaaactactccattaccgtcagcgaccctgtcaacattcgcgacggcatcatac
ggtggaactcaccagccggccacaaaaacgtatcctttcgacaaggttttcgggccagaa
gctgaccaaacaatggtttttaacgaggttgctgaaggaatgctgggggaagttctgtca
ggatacaattgtaccatttttgcttacgggcagacaggtactggaaaaacctatactatg
caaggcgaccttgagctcacaaatcttgacgctccgaaatcgacggctggtattgttccg
agggtccttcaccgtcttttcagcatcctcgaatctcaagccgacaccgagtactcgata
aaatgctcttatgtggaactgtacaatgaagagcttcgagatctcctagcgccggagtac
agaggtgaacaaagtgggactggcggactcaagctgtatgaagatggaaaaaaggggact
atgattcagggcctggaagagacaggcgtaaggaacttgaaagaggccttgggtatgttg
gacaaaggagtgaggagaagacagaccgccgagacaaagatgaacaccgaatcttcccgt
tcacatacaatcttctctatcacggtccatgttaaagaaagcggagtgcaaaggggaggc
gaggacatgcttcgaatcggaaaattcaatctagtcgaccttgctggctcggaagctatt
ggccgttctggtgctacagacaagcgcgctcgtgaggccggtatgatcaatcagtctctc
ctcaccctcgggagagtcatttcggctcttgtcgagaaaggcagtcatatcccttatcga
gaatcaaaacttactcgactattgcaagattccctgggtggtagaacaaaaacttgcatt
gtcgcaactatcagtcctacccgatccaacatggaagaaactctttccactcttgattac
gccatccgcgccaagtctatccgtaaccgaccagaagtcaacgctcatctcacaaaggcc
ggcttgctcaaagaatatgtcggagacattgagcgtctcaaagcagaactcgctgcgaca
agagagaagaacggaatatatattcccgaagatcaatggcgggagatgcatgaaaatcag
gtgaagcagaaatcagattatgacgaggccaaactcaaggcgagcgtcattgaagttgct
ttggacacgaagaaaaaggagtttgatgaagtcagtgtgcggttgcttgcgacggtcgat
gaacttgctcaagtgagggaagctgagaagcaactgacggaaatgcttgacgaaacgaag
atcgtacttgacactatcaagacaagactagatgaggagacggtcattagccaggcgtat
atgcaaggagaggagagactagacgcagttgccggaggcctgaagaaagtggccactgag
agtgtgaatgacgttggaggattgtttgaaaagatcgcccgaaaggccaaggtactcgga
tccaacgcaagcgcagctactcaatttggtggtgaactgcaggggctctcccagggcctt
cgcaacggtttatcgcagctgcaatcagctcatgacaatttcgggcaagaaatccaaatc
gaaatggaagcctatgccctcaaagaacaacaagctacaaagcatgaccttgctgctctc
gatcgatcctttgtggctttcaacgacctctcccaaaaacttgctgcgtcaaatgagaag
ggtcaacgcgaagcatcggatttaagcaagtccttgttgactgtcaaggatgaagtgcag
aattctgttcgcgaatgggcgcagggtgtgagcgagagaagcaagtccatggtcgacgaa
ctactcggacaccaacaacagcacctcacagctgtcggttcagtactcgactctactgcc
agtcttgtcgacgcaattatcactaccgcacaaaaacacctcgctgctgagtcagcatct
gctcttcgtgcgcgtgatcttgctatacagacatcatcatccgagatcacccgacttcgc
tcccagaacctcctcctggccaaactcctttccgaggaaaaagcgaagacagccaaactt
cgcaccgaactcattggtaacttgacaagtatgatcgagagtttcacggatgaacaagac
aagggcttaagtgcggtggttgacaaagtcaagatggagaatgaaaaaagtgttgaggag
atggaagaatttggcgaggaagcaaggagtgtatgggaagaaggggatgggagaagaaag
ttattcgaggatgaggtaagatcgggcggggaaagggcggtattgcaaaagggagaaggt
cagctggctcttgggcaagttcgtgaaggtttgagagagagactagagagttatggtcaa
gaaacaatggaagaggcagaggcgcacgttgaagtggtggatggtttctgcgtcaagatg
gcgaagagcgctacaagtgttgcgaacaagtcaacagctcgaggaaagaagaattcagag
attatcgaagctttggcgaggaacgtgaaatccacgcatgaagcctcccaagcaagatct
tctgccatggcagactctattgacagccttacttccactcttcttacctctcaatcgtca
tcttcagccactttctcacaagcctactctgcaaccgagtctaatctcaactctatcatg
tcctccactgccgatttcctgaagtctggtatccaagaagatattcctaccggtattact
ccacgtaagaaggtatggaacgtccaggccgaatgggagaggacgggacccagagaagcg
gttttggcgagctggcgaaaaagacaagagtcggcggaacaatcagaaagcgaaaacgga
gtcagagatgaatcgcaagtaactaccaacagacgcattttaaggctccgaaggactgac
agtcgcaagctcccaggggtggtgaatgacgaggcgagcgaagcagccgacgaggtcttg
gaagacggggtctctcaaactgaatctcaagcgagtatcagtagtaccatcatgtcccgg
acaagctctcgcgagccaaccccaacgggtatccctcctcccccatcgatacccagcacg
cgtacctcttctggtcagacaataccgacccgatcgaaactgacaagatcaacaaccggg
aagaagcttggcaatgaaatcgccgacgaaccccggcctgcggtgacggttttgggagaa
ggtggagtgaatcttccgaggcgcggtgaacgtaggtaa

DBGET integrated database retrieval system