KEGG   Cryptococcus neoformans var. neoformans JEC21: CNG01350
Entry
CNG01350          CDS       T00243                                 

Definition
(RefSeq) hypothetical protein
  KO
K18798  peroxisome-assembly ATPase [EC:3.6.4.7]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Brite
KEGG Orthology (KO) [BR:cne00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cne03029]
    CNG01350
Enzymes [BR:cne01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.7  peroxisome-assembly ATPase
     CNG01350
Mitochondrial biogenesis [BR:cne03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CNG01350
SSDB
Motif
Pfam: AFG1_ATPase AAA_16 AAA_22 AAA_5 AAA
Other DBs
NCBI-GeneID: 3258578
NCBI-ProteinID: XP_571824
UniProt: Q5KE88
LinkDB
Position
7:join(392038..392290,392354..392514,392568..392995,393044..393501,393551..393658,393716..393729,393785..393928)
AA seq 521 aa
MRTTLYFTTVKASSSRVTLAPTARPLANHAAVISLSPGPTHLPCGGLSSGAAIRHIHLTG
TARREKQSLTSTTTHIVEARASFKDPVTRYEHLVKDKVLRSDPYQRGIIQKLQRLWDDLK
DYDPGPVPAAAVQPSSSIFSRFFSKGPSQSEVTIPLSNVPKGLYLYGSVGTGKTMLMDLF
HSTIPKQFRPTSQGGYGSIRIHFHAFMLDVLQRQHKLVVEYEKAGLGKKDVLPEVARSLA
NEGRVLCFDEFQVTDIVTAMILRGLLERLMSFGVVCIMTSNRHPDELYINGIQRQSFIPA
IELIKERFEVVDLDSGTDYREIPRALSKVYYNPLSPTVKSEINKLFDSFASTDPVSSEVV
HNRKVHLWGRELNVPESSGSVAKFTFADLCNKPLSAADYLEVTSKFGTVFVEDIPRMGLS
ERDQARRFITFIDACYENKTKLFCSSEVPIFQVFSDKHGSAAEDAHMQEVMDELGLDPSA
VGSSSLFSGDEELFAFARCVSRLSQMGTKQWSETAGPLAGA
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgaggacaactctatattttacaacagtcaaggcttcaagctcaagagtcactttggct
cccactgctcgccctttggccaaccacgcggctgtaatctcattgagccctggacctact
catttgccatgtggcgggctatcttcaggagctgccataagacatatccatttgacagga
acagccagaagggagaagcagagtcttacttccaccactacccatattgtcgaagctcga
gcatcgtttaaagatcctgttacaagatatgagcatctcgtcaaagataaagtgcttagg
tcagatccataccagagaggaattatacagaagcttcaaagattatgggatgacttgaaa
gactatgatcctggacctgtgccggctgcagctgttcagccttcatcctccatcttcagc
agattcttctctaaaggcccctcacaatctgaagtaacaatccctttatctaatgtcccc
aaaggtctctacctctacgggtctgttggtacaggcaagactatgcttatggatctcttc
cactccactatccccaagcaattccggcctacctctcaaggcggttatggatctatccga
atacatttccacgccttcatgctcgacgtccttcagcgacagcataagttggtcgttgag
tacgaaaaggcggggttgggaaaaaaggacgtgttgccagaggtagcgaggagcttagcg
aatgaagggagggtattgtgcttcgatgagtttcaggttacggatattgtcactgcgatg
atccttagagggttgttggaaagactcatgagctttggcgtggtttgtatcatgacttcc
aatcggcatccggatgaactctacatcaatggtatccaacgacaatccttcatccccgcc
atcgagctcatcaaagagcgcttcgaagtcgttgaccttgactctggtaccgactatcga
gagattccccgggcgctttccaaggtgtactataaccctctctctccaacagttaaatcc
gagatcaataagctgtttgattcttttgcttcgacagaccccgtctcctctgaagttgtc
cataaccggaaggtccacctttggggacgagaactgaatgttcccgagtcgtcgggaagc
gtggcgaaattcacttttgcggatttgtgtaacaaacctctgagtgctgcagattatctc
gaggtgacgagcaagtttggtacggtgtttgtggaagatataccgaggatgggattgagt
gaaagagatcaggcgaggaggttcatcacgttcatcgatgcatgctacgagaacaagaca
aaacttttttgttctagtgaagttccaattttccaggtgttctccgataagcatggctca
gcagccgaggacgcacacatgcaagaggtcatggacgaacttggtcttgatccttcagca
gtgggatcatcctcattattctccggcgatgaagagctgttcgcgttcgcgcgatgtgtt
agccgattgtcccagatggggactaagcaatggtccgaaacggcagggccactagcgggt
gcttaa

DBGET integrated database retrieval system