KEGG   Cryptococcus neoformans var. neoformans JEC21: CNG01370
Entry
CNG01370          CDS       T00243                                 

Definition
(RefSeq) ATP-binding cassette (ABC) transporter, putative
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
SSDB
Motif
Pfam: ABC_tran ABC_membrane SMC_N AAA_22 AAA_25 AAA_24 cobW PRK MeaB
Other DBs
NCBI-GeneID: 3258705
NCBI-ProteinID: XP_571828
UniProt: Q5KE86
LinkDB
Position
7:complement(join(397718..397768,397825..397948,398006..398207,398258..398575,398632..398754,398809..398896,398946..399064,399116..399202,399259..399410,399461..399585,399636..399727,399778..399849,399905..399966,400023..402472,402538..402788,402840..403537,403593..403696))
AA seq 1705 aa
MADSSWVSAASKAISDSSCDKVWDGIDFSSCFREKYLQNVPYLLIAASALYLLSTYPSRW
ARRSQDPLSTSTLVSSSYPSDLANLESSVILDSLATNLLPPWSASTPSKPAEKLPEGEAE
RVIMDFVKHKRRDVTRLQDLRFWIGLLGAVTWFEVELARAVVQGSWKDVIFPAWLSLISI
IPHSHITPLLSLHSMTSLIFFRTLIIHPNPSKLHIACFAVEMVYCIAMLGLPYHEGLDRL
LEGAKSKGGGSLGSFGSKLPKHYEEPASAWSRGTFNFLLPLLFKHYLTPITLENIPAIRE
DDSSAASLGAFRAFSAKRDATYAKKHSGAKRRRNLGLELAVFFAPELGWQVLWASIFIFF
QYLPPNGLRLLLQYVKQRETNPQPTHVAVLYVAMMVIGQCMSAITLAQALYLGRRLCIRI
RAIIIAEVFAKALRRRDVSGDVKKSTSNKSSAAAAGKKGNNQAQDGAEGEATAGEGKIAN
LVSVDAFTISEICAYSYYTVSCPLAIVVNSVLLYQTLGTAAFAGIAVLVALMPAQYGMSK
LYMSRQKKFMTATDARLEGITEVIAHIKLIKFNAWEGKFFDRMMITREKELRMLARRFAT
TVLFQLLVWSTPVIVTGIAFAVHSLWLKQPLTADKAFASLILFNMLKDPLALAQDTVTRL
IQASTSCNRIQKYLEEPDTLKYQQLSTPGSNDPQIGFRDAVLGYLTPEEATKLESDQSEP
FTLRELNVSFPVGKLSVVCGPVGSGKTTLILGLLGETLLLKGQVFMPDDHANRDGCPIDP
ATGLADTVAFCAQTPWLVGASIKENIVFGSNWDKKRYDHVVKACALQRDFEIFELGDETE
VGEKGTTCSGGQKARISLARAFYSSAKTIILDDVLSAVDAHTARHLYEQILQGPLTQGRT
VILVTHQVNLVSPAAEMVVMLDNGIVTASGSPSELTASGALELSEDDSDKASASASTAAS
TTLGAGSGSPVERDTDDPYIEDQLDSPAEEELVEQQKQVDADRAAQTDKTTRLGKQLVAA
ETSSQGTVQAATYMLYFKALGGITIWIIVIIVFFGSQMLQVANNAWIKEWANADDRAASG
SLLGKAAFTVYQFVIDTRKYVQAEMERKHSTAYYLAIYWAISAFYLIAVVGRVGISFIGA
LRASRHMYDRLLQRILGARMRFFDSTPSGRILNRLSKDMSSIDQETGEICMYFANSCLSA
ATVLVVVTVSTPAFLGALVLICFLYWVIGSLYVATNREIKRIDSVTRSPIFISFTEVLVG
MSTIRSYGDSARFMRKLFHELDQNTRCFWYLWQVNRILNNYSNFVGALVTVFAALFALKN
KSMDAGAVGLSVSYALSFTEYVLWVVRLYAAVEMSMNSVERVGEYLELEVEEESHEKGKE
PPAYWPTSDGSIVVENLTCRYAPQLEPVLKDISFVIGPKEKIGVCGRTGSGKSTLALSFF
RFLFQESGKITIDGEDISKLSLNALRSRLTILPQEAQLFSGTVRDNLDPFDQHEDADIWD
ALAQCGLVGKSRLSSRATSRAQSRTDLSALSSSTTKEPNAPLVKSVLKKSLKNAEEGDEE
GERVVIRSLEEKVAVGGKNFSQGQRQLLALARGLLKLRNSSFLIMDESTANLDHATDATI
QNVLRTGLADTQMLVIAHRLMTVAGLDKILVLDHGKVMEYGTPWELMQNEGGIFRELCKQ
SGEETQLWEVAKIVYETKQNASSRS
NT seq 5118 nt   +upstreamnt  +downstreamnt
atggcagactcctcatgggtttctgcggcttccaaagccatatcagattcgagctgcgat
aaagtctgggatggtatagatttcagctcatgcttccgtgaaaagtatctgcaaaacgtt
ccatatctccttatagcggcttccgccctctaccttctctccacctacccatctcgctgg
gcccgtagatcccaggatcccttatcgacctcaactctcgtctcttcttcttacccctca
gacctcgccaacctcgaatctagcgttatcctcgattccctcgctaccaacctcctcccc
ccatggtctgcatctaccccatcgaaacccgcagagaaacttcccgagggcgaggctgag
cgggtaattatggattttgtcaagcataaaaggagggacgtgacgaggctacaagattta
aggttttggattggtcttttgggtgctgtgacttggtttgaagtcgagctagcgagggcg
gtggtgcaaggaagctggaaggacgtcatatttcccgcctggttatcgctcatctccatc
atcccccactctcacatcacgcctctcttgtcattacattctatgacatcgcttatcttt
tttcggaccttgattatccacccgaacccttcgaaattgcacatcgcgtgttttgccgtg
gagatggtatactgcatcgcgatgctggggttgccataccacgagggtctggataggttg
ttggaaggtgcgaagagtaaaggaggaggtagtttgggaagctttggaagcaagctgcct
aagcattatgaagagcctgcttcggcatggtctcgaggaacattcaattttttgcttccc
ctgctttttaagcactaccttactcccattacgttggagaacattcccgctatccgtgaa
gacgattcatcagctgcttccctcggtgctttccgagctttcagtgctaaacgggacgct
acttacgccaaaaaacatagcggggccaagaggagaaggaatctgggtcttgaactggct
gtgttctttgctcctgaactcggttggcaagttctctgggcgtcaatcttcatcttcttc
caatatctccctccaaatggtcttcgattactcctgcaatacgtcaaacagcgagagact
aacccccagccgacacacgtagccgtcctctacgtggctatgatggttattggacaatgt
atgtccgcaatcaccctcgcccaggcattatacctcggtagacgattgtgtattagaatt
cgagcaattatcattgctgaagtatttgcgaaagctcttcgaaggagagatgtctccggc
gacgtgaaaaaatcaacatctaacaaatcctccgctgctgctgctggtaaaaaagggaac
aaccaagctcaagacggcgctgaaggtgaagctacggcgggcgaaggaaaaatcgcgaac
ctcgtctctgtcgatgcgtttactatctccgagatctgcgcttactcgtattacaccgtc
tcctgccctctcgccatcgtcgtcaatagtgtgcttctttaccaaaccctcggcaccgct
gctttcgcgggtatcgccgtcttggtggccctcatgcctgctcagtatgggatgagcaag
ctctacatgagccgccagaaaaagtttatgacagctaccgacgcaaggctcgaaggtatc
accgaagtcattgcccacattaaactcatcaaattcaacgcttgggagggcaagttcttt
gaccggatgatgattactcgtgaaaaggagttgcgcatgctcgctcgccgattcgcgact
acagtcctattccagctactcgtatggagtacaccggtgatagtcactggtatagctttt
gctgtgcatagcttgtggttgaagcagcctctcacggctgacaaggcgtttgcatcgttg
attctgttcaacatgctgaaagaccctcttgccctcgctcaagacactgtgacaaggttg
atccaagcgtcaacctcttgtaatcgtatccaaaaatatcttgaggaacctgacactctc
aagtaccaacagctctccactcctgggtccaatgaccctcaaatcgggttcagagacgct
gtcctcggttatttgactccggaagaggctaccaaactcgaatccgatcaatctgaacct
tttactcttcgcgaattaaacgtgtccttccccgtcggtaagctgagtgtggtctgcggc
ccagtgggctcaggaaagacgaccctcattctcggtttgctcggtgagacactgcttctc
aagggacaggtgttcatgccggacgatcatgccaatagggacggatgtcctatcgatcct
gccaccggacttgccgataccgtagcattctgcgcccaaacaccttggttagtcggtgct
agtattaaggaaaacattgtttttggttccaattgggataaaaagaggtatgaccatgta
gtcaaagcttgtgctctccagcgagacttcgagatctttgagcttggcgatgagacagaa
gtgggagaaaagggtactacctgttctggcggccaaaaggcgcgtatctcccttgctcgt
gctttctactcgtccgcaaagaccatcatcctcgacgacgttctctcagcagtggatgcc
cacacggctcgacacctgtacgagcaaattcttcagggaccgcttacccagggtaggaca
gtgattctcgtgactcaccaggtgaatttggttagtccagcagcggaaatggtcgtcatg
ctcgataatgggattgttaccgcttccggctctccttcagagttgacagcttcaggtgca
ttggaattgtcggaagatgatagtgacaaggcgagcgctagcgcaagcaccgctgcgtct
actacattgggggccggaagcggttcacccgtcgaacgtgataccgatgacccatatatt
gaagaccaactcgactccccggctgaagaagaactcgttgaacagcaaaaacaagtggac
gcagaccgtgctgctcagacagacaaaaccacccgtctcggcaaacagcttgtagccgcc
gaaacttcatctcagggtactgtgcaagctgcaacatatatgctctacttcaaagctttg
ggaggtatcactatctggattatcgtgattattgtgttttttggttcccaaatgcttcag
gtcgcgaacaatgcttggatcaaggaatgggccaatgctgatgacagggcggcttctggt
tcgctcttgggcaaagcagcattcactgtctatcagttcgtgattgacaccaggaagtat
gttcaagcagagatggaacgaaagcattcgacagcgtattatctggcaatatattgggcc
atctccgctttctacttaattgctgttgtcggtagggttggtatttcttttatcggagca
ttgagggccagtcgtcacatgtatgatcgtctgttgcagcggatcttgggcgcgaggatg
aggttctttgattctacaccttcgggtcgaattctgaaccggttgagtaaagacatgtct
tctatcgaccaggaaaccggtgaaatctgtatgtactttgccaactcatgtctctcggct
gcaaccgtcttggttgtcgtgactgtatcaactcctgcctttctcggtgctttggtcctt
atttgtttcttgtactgggttattgggtcactctacgtggccactaaccgagaaatcaag
cgcattgacagtgtcaccaggtctcccatctttatcagcttcactgaggtccttgtcggt
atgtcaacgattcgctcttatggcgatagcgcccgcttcatgcgcaagctattccatgaa
cttgaccaaaacacacgttgcttctggtacctatggcaggtcaatcgaattcttaacaac
tactcgaacttcgttggcgctttggtcactgtctttgctgcgctttttgctctcaagaac
aagtcgatggatgctggtgcagtaggattgtctgtcagttatgctttgtctttcactgaa
tacgttttgtgggtcgtcaggctatacgctgctgttgaaatgtccatgaacagtgttgag
cgtgtaggtgaataccttgaacttgaagtcgaagaagagagtcatgaaaaagggaaggaa
cctcctgcctactggccgactagcgatggatcgatcgttgttgaaaatctgacctgtcga
tatgctcctcagctcgagcctgtcctcaaagacatctcattcgttattgggcccaaagag
aagataggtgtatgtggtagaaccggtagtggaaagagtactcttgctctttcattcttc
aggttcttgttccaagaatctggtaaaatcacaattgatggcgaagatatctcaaaactg
agcctcaatgcgctcaggtcaaggcttaccatccttcctcaagaggcccagctcttctcc
ggaactgtacgtgacaacctcgatccatttgatcagcatgaagacgccgatatctgggat
gcccttgctcaatgcggtcttgttggcaaatctcgactctcaagccgcgctacaagtcga
gctcaatccaggactgacctgagtgctttgagctcctctactactaaagagcctaatgcc
cctcttgtcaagagcgttctgaagaaaagcttaaaaaatgccgaggaaggtgatgaagag
ggggaacgggttgtcatcagaagtttagaagagaaagtcgccgtaggtgggaagaatttc
agtcaaggacaaaggcaacttcttgctcttgctcggggtctcctcaagctccgcaattcc
agctttctcattatggatgaaagcacagccaacctcgaccacgccacggatgccacaatc
cagaatgtgttgcgtacaggtttggctgatactcagatgttggtcatcgcccatcgcctg
atgactgtcgctggtcttgacaagatcttggtgcttgatcacggaaaggtaatggagtat
ggtacaccttgggaattgatgcagaatgaaggaggcatctttagggaactgtgcaagcaa
agcggagaagagactcagttatgggaagtggccaagatcgtctacgaaaccaagcaaaac
gcttcatctaggtcctag

DBGET integrated database retrieval system