KEGG   Cryptococcus neoformans var. neoformans JEC21: CNG01390
Entry
CNG01390          CDS       T00243                                 

Definition
(RefSeq) hypothetical protein
  KO
K03680  translation initiation factor eIF-2B subunit delta
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cne00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    CNG01390
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cne03012]
    CNG01390
Translation factors [BR:cne03012]
 Eukaryotic type
  Initiation factors
   eIF-2B
    CNG01390
SSDB
Motif
Pfam: IF-2B
Other DBs
NCBI-GeneID: 3258682
NCBI-ProteinID: XP_571832
UniProt: Q5KE84
LinkDB
Position
7:join(405798..406502,406554..406681,406735..407257,407316..407378)
AA seq 472 aa
MAEQEPQVQSQQQKQQKQKPQQPPSGEPKAKSAKELKKEKRAAAVASRAIPTEGGVPEGP
QGGKQSSSTATSDGRRSPVVHLNPSSQNPASSAGPSAPRRPPNHSEPSAPTLSVIQQNLF
FSHLPHQTPADTVSALDTGKIHPIIVRVGVLMNSGQLRGANARTIGMMSAFKEVIRDYEC
PDQAVLWKDLPVYLSPMIAWLETCRPKGVGGGNAIRWLKSEINRLGEKGDKSEAEQKSYL
VDAIGLYLRDRIEFADQVIADSAKEKIKPGDTVVTFARSSVVETVLLEAWTSMREQDPDA
TFNVVIVDSRPLLEGEKLLKVLTAAGLPCTYILLPLLSSILPQADLVLLGASALHSDGAL
YSRAGTAVVAMLAKEHRVPVVACVETYKFGERVVLDGVATNELGDVEGLLALPTKKPFAL
GKEGKPLPSNLTPLHVVYDVTPPSLITAVCTEIGFIPPSSVPTVLGKSNGVV
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggccgagcaagaaccacaggtccagtcccaacaacaaaaacaacaaaaacaaaaacct
caacaacctccttcaggcgaacccaaagccaaatccgccaaagagctcaaaaaggagaaa
cgcgccgctgctgtcgcttcccgagccatccctaccgaaggaggagttccagagggtcca
caaggtggtaaacaatcatccagcactgccacttctgatggccgtcgctctcccgtggtt
catctcaacccttcttctcaaaatcccgcttcttcagccggcccttccgcccctcgcaga
cctcccaaccactctgaaccctcagcgcctaccctctccgtcatccagcaaaaccttttc
ttctcccatctgccacaccagactcctgccgataccgtctccgccctcgacacgggcaag
atccacccgataatcgtccgtgtgggtgtgctgatgaacagtggacagttgaggggtgcg
aatgcgagaacgatcgggatgatgtcggcgtttaaagaggtgattagggattatgaatgc
cctgatcaagcggttttgtggaaggatttgccagtgtatttgagtccgatgattgcttgg
ctggaaacttgcaggcctaaaggtgtgggaggcggtaatgctatccgatggttgaagagt
gagatcaataggttgggtgagaagggggataaatccgaggcagagcaaaaatcgtatttg
gtcgatgcgattggtctctaccttcgcgacagaatagaatttgcggaccaggttattgca
gacagcgcaaaggaaaagatcaagcctggagacactgtcgtcacttttgctcgatcatct
gttgtcgaaacggtcttactcgaagcctggaccagcatgcgagaacaagaccccgatgca
accttcaacgtcgtcatcgtcgactctagaccccttctcgaaggtgaaaagcttctcaaa
gtgctcaccgccgccggccttccttgtacttacattctcctccccctcctctcctctatc
ctccctcaagccgacctcgttcttctcggcgcctctgccctgcactcggacggtgctctc
tactcccgcgcgggtactgctgtcgtcgccatgctcgccaaggaacatcgcgtccccgtc
gttgcttgtgtagagacatacaagtttggagaacgtgtggtgcttgatggtgtggcgaca
aatgagttgggtgatgtggagggtttattggcattgccgacaaagaagccgtttgcatta
ggtaaggaaggtaagccgttgccgagcaatttgactcccttgcatgtcgtgtacgatgtg
accccgccttcgttgattaccgccgtttgcacagagattggtttcattcccccaagctct
gtgccgaccgtcctcggtaaatccaatggtgttgtgtga

DBGET integrated database retrieval system