KEGG   Cryptococcus neoformans var. neoformans JEC21: CNG01400
Entry
CNG01400          CDS       T00243                                 

Definition
(RefSeq) conserved hypothetical protein
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
SSDB
Other DBs
NCBI-GeneID: 3258768
NCBI-ProteinID: XP_024513193
LinkDB
Position
7:complement(join(407500..407880,407935..408174,408228..410467,410522..410737,410799..410913))
AA seq 1063 aa
MAAQAESSHCILESSPRVPTPAKQLQVKKRVVNLVNPADVEDFSPQKSTSPTGSPANTHT
ITEFLKAKTSSPPILPRLSELQQQAGNLTPNGSGVKGILRPSGTPGSGNGVRFFHKKQFR
VITPNSSVLPPSPAKPPPTPTSSSFFSQLLAVTMSPRRKEPESEPEPVGNEESWEKPGEE
GELSLVASTGSAGSIIIHGDEDEEDVEEEEPWNGEPQIHSSPLGLPAVPEGNTSKDASYG
EFELPSVEWHLPEDMSNLLSTKFPEKDSFSVADPTSTSTTASSRDLFADQSSFRDGLTSE
AAASRSLKHGKVERRAEAEFWGVQPDESAMSELGREDSNPTIRCQLPPLEEQIPTIEEKS
ETQESPLSIAQPEPPMTAPYSTSSIFADMSAEQAELTWPLTHRPGPDSSSTFQSPSRIQS
PEPPEVAPETPRTTAGDVTEFYDCTAMVLSPSSDSPLATCSSSAPLTSLLVQPTKALFEA
QTAHTIALSTELELYKDLTEKLRNEVSERDEVLAKLNMRALEAEMLYSQVQDLKKALAVA
NAKAQQAEVQAQTAQQQTLPNLDLNSPTPLMRTRSAGLPSDRTMAAQSEARDLEIRLAKA
LADAAATSRQLEEVKNSRDQQALQLEEARAELRDKDDREKSRLIKASHPEENEEDGEVEK
MRKEMKELQRKVGEMEGKEEEVQALRQELEEVHRELEEVKDQGSEVQALRTELSSAHHQL
DEYELMKADVDALQKELADLRHHVQELKQVKAADEEEIETLLDQVAKLEVESRDVEDLKY
HFDQLKQVKTANEEEIENLLRQIEKLKAERRQEDEWKSKVEELSKRVDMEGMRRQNVELE
LEEVRSREIKLEGENRELRKSLQSTREQLVQAQSVPTTSLADAQELQSLRVQIDHLKSQS
ASKDLEITNLQRRKAELKEDREMLNIALDSKQQEVELMKRKFGVRGVAGSTPLGASQRTN
LDQGTTPSMTNESFLPKTLTRRRSSLAIQTPVPDYSKRHSLETPLQGNHRHGVQLYPSTK
VASRVMQRSESREENIPPSRASVGGSAARYGSLRTKEREMTLA
NT seq 3192 nt   +upstreamnt  +downstreamnt
atggctgctcaagccgagtcaagccactgcatactagaatcctctccaagggttcccacc
cctgcaaagcagcttcaagtaaagaagagagtggtgaacctcgtcaacccagccgatgta
gaggatttttcacctcaaaaaagcacttcacccacagggtctcctgctaacacacacact
ataactgagtttctcaaagcaaagacgtcctctccgcctatccttcctcgcctaagcgaa
ttgcaacagcaagcaggaaatcttacaccaaacggcagtggtgtgaagggcatcctgaga
ccttctgggactcctggttctggaaatggagttcgattcttccacaagaaacaatttcga
gtcattacccccaattcctccgtccttccaccatccccagctaagccaccaccaacaccc
acatccagctctttcttttctcagctacttgcggtcactatgtctcctcgtcgtaaagag
cctgaatctgagcctgagcctgtagggaacgaagaaagttgggagaagccaggtgaagag
ggtgaactatcattggtcgcttcaactggatcggctgggagcatcatcatccatggcgac
gaggatgaagaagatgtggaagaagaggaaccttggaatggcgagccccaaatacactcc
tcgcctttaggattacccgctgtacctgagggcaacacatccaaagatgcgtcctacggt
gaattcgaacttccttcggttgagtggcaccttccagaagatatgtcgaacctgttatct
acaaaatttccggaaaaagactcgttctcagttgctgatccgacttcaacctccaccact
gcttcatcaagagacttgtttgccgatcaatcttcttttcgagatggcttaacttctgag
gcagccgcctccagatcactgaaacacggcaaggtggagaggagggccgaagcggaattc
tggggcgtacagcccgacgagtccgccatgtctgagctcggcagggaggatagcaacccg
acaatccgatgccagctacctcctcttgaggagcaaatccctactatcgaagagaaatca
gaaactcaagagtctcctctctccatagcacaacctgaaccccctatgactgccccatac
tccacaagttcgatattcgccgacatgagtgccgagcaagctgagcttacttggccactc
actcatcgcccggggccagattcttcttctactttccaatcgcccagccgtatccagtcc
ccggaaccgccagaagtagctcccgaaacccctcgaacaacagcaggagacgttaccgaa
ttttacgactgtacagctatggtcctatccccctcctctgattcacctcttgctacctgt
tcttcgtcagcaccccttacgagcctcttggtacagcctacaaaagctctcttcgaagct
cagacagctcatacaattgcactcagcaccgaacttgaactttacaaggatcttaccgaa
aaactccgcaatgaagtctcagaaagagacgaggtgctcgctaaactgaatatgcgagct
ttggaagcggagatgttgtactcccaggtgcaagatctgaagaaggcgctagctgttgct
aacgcaaaagcacaacaagcggaggtacaagctcaaaccgctcaacagcaaacattgcca
aatctagacttgaactctccgactcccctcatgcgtacccggagtgctggtcttccctct
gataggactatggccgcccaaagtgaagcgcgtgacctcgagattcgacttgctaaagct
ttagcagatgccgcagccacctcgcgccagctggaggaggtcaagaattctcgagaccaa
caagctcttcagctcgaggaagcccgagctgaattgagagataaagatgatcgtgagaaa
agccgcctgatcaaggcttcccaccccgaagagaatgaagaagatggggaagtggagaaa
atgcgaaaagagatgaaggagttgcaacgaaaggtgggagagatggagggcaaggaagag
gaagtacaagctttgaggcaagagttagaagaggtacatcgtgaacttgaggaagtcaag
gatcaggggagtgaggttcaagctctcagaacggaactgtctagtgctcatcaccaactg
gatgaatacgagctgatgaaggccgacgtggatgcccttcaaaaggagcttgccgacttg
aggcaccacgtccaggagctcaaacaagtgaaggccgcagacgaagaggagattgaaacc
cttctggatcaggttgccaagcttgaagtcgaaagtcgagacgtggaggatttaaaatat
cattttgaccagcttaaacaggtcaaaacggccaatgaggaagagattgaaaaccttttg
aggcaaatcgagaagcttaaggcggagagaaggcaggaagacgagtggaagagcaaggtg
gaggaactgagtaagagagtagatatggaaggcatgagaaggcagaatgtagagcttgaa
ctagaggaggtcaggagtagggagatcaagctggaaggagagaaccgagagcttcgaaag
agccttcaatccactcgggaacaactcgttcaagcacagtcagtccctaccacctccctg
gccgacgcgcaggaactccaatcgctccgcgtccagatcgaccacctcaagtctcaatcg
gcttcgaaagacttggaaatcaccaatcttcaacgacgtaaagcggagttgaaggaggat
agggagatgctcaacatcgcattggattcgaagcaacaagaggtcgagctgatgaaacgg
aagtttggagttcgcggagttgcgggtagtacacctctcggagcgtcccaacgcactaat
ctcgaccaaggtaccactccttccatgaccaacgaatctttcctccccaagacccttact
cgccgtcgatcgtctcttgcgatacagacccctgtcccagactactctaagcggcattca
ctggaaacgcctttacaaggcaaccaccgccacggagtgcagctgtatccgagcacgaaa
gttgcatcaagagtgatgcagagaagcgaatctagagaggagaacatacctccatcacgc
gcatctgtgggtggtagtgcagcgaggtacggtagtttgagaacgaaggaaagggaaatg
acactggcataa

DBGET integrated database retrieval system